KEGG   Drosophila grimshawi: Dgri_GH10129Help
Entry
Dgri_GH10129      CDS       T01061                                 

Definition
GH10129 gene product from transcript GH10129-RA
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH10129
Transfer RNA biogenesis [BR:dgr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Dgri_GH10129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 561 aa AA seqDB search
MKQKKKLAVGLSREERQVLVIGEIIQELLKAHEAKKDVNLNRMKSLISSKYGLDNSPRLV
DIIAAVPQDAKKILLPKLRAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALS
EEYRDYFIRNLHDALSGHSSANVAEAVRYSEKSRTKCIGITIETRPDYCLKRHISDMLNY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVCETFNMGKDAGYKIVTHMMPDLPNVDFERDI
EQFIEYFENPAFRSDGLKIYPTLVIRGTGLYELWKTGRYKSYPPSMLVDLVAKILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTVCRDVRTREVGIQEIHNKVRPY
EIELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRKCSPDTFRPELQGGCSIVRELHVY
GSVVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSIKIAVISGVGTRNYYRKLGYELD
GPYMSKPISNPMQTELVYEYV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaagaagaaacttgctgttggtctcagccgtgaggagcgccaggtgctcgtc
attggtgaaattatacaggagctgctgaaggcacacgaagccaaaaaagatgtgaatcta
aatcgcatgaaatccctgatttcctccaaatacggcttggataattcgccacgactggtg
gacatcatagcagctgtgccgcaggatgccaagaaaatattgctgcccaaattgcgcgcc
aaaccgataaggacagcaagtggaattgctgttgtggccgtgatgtgtaaaccgcatcgt
tgtccgcacatcaattttacgggcaacatttgcgtctattgccccggcggaccggacagc
gatttcgagtactccacgcaatcctatacgggctatgagcccacgtcgatgcgtgcaatc
cgtgcacgctacgatcccttcctgcagacccggcatcgtgtcgagcagctgaagcaactg
ggacactccgtagacaaggtggagttcattgtgatgggcggcacttttatggcgctgtcc
gaggaatatcgcgattacttcattcgcaatctgcacgatgcactctccgggcatagcagt
gccaatgtggcggaagctgtgcgttactcggagaaatcacgcaccaaatgcattgggatc
accattgaaacacgaccggactattgcctaaaacgtcacatttcggatatgttgaactat
ggctgcactcgcctcgagattggcgtacaatccgtctacgaggatgtcgccagggatacg
aatcgtggacacacagtgcgcgctgtctgcgaaacgtttaacatgggcaaagatgctggc
tacaagattgtcacccacatgatgcccgatctgccgaatgtggattttgagcgtgatatt
gaacagtttattgaatactttgagaatcccgcctttcgctcggacggtctgaaaatctat
cccactttggttatacgcggcactgggctctacgagctgtggaagacgggtcgttacaag
tcgtatccaccctctatgctggtagatttggtggccaaaatactggcactggtgccgccc
tggacgagggtctatcgtgtacagcgagatatacccatgccactggttagttccggcgtg
gagcacggcaatctgcgtgaattggcgctggcgcgcatgaaggatttgggcacggtgtgc
cgggatgtgcgcacccgtgaggtgggcatccaggagatacacaacaaagtgcgtccgtat
gaaattgaattgatacgccgtgattacgttgccaatggtggctgggagacgttcctctcc
tacgaggatcccgaacaggatatactcgtgggtttgctgcgcctgcgtaaatgttcgcca
gacacttttcggccggagttacaggggggctgttctattgtgcgggagctgcatgtctat
ggctctgtggtgccagttagttcgcgggatccgaccaagtttcagcaccagggctttgga
atgctgctcatggaggaggcggagcgtattgctcgagaggagcacggtagcatcaagatt
gccgtcatctccggcgtcggcacaaggaactattatcgcaagctgggctacgagcttgat
ggtccctatatgtccaagcccatatcgaatccgatgcaaacggaactcgtctatgaatat
gtgtga

DBGET integrated database retrieval system