KEGG   Drosophila grimshawi: Dgri_GH10546Help
Entry
Dgri_GH10546      CDS       T01061                                 

Definition
GH10546 gene product from transcript GH10546-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dgr  Drosophila grimshawi
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH10546
   00053 Ascorbate and aldarate metabolism
    Dgri_GH10546
   00500 Starch and sucrose metabolism
    Dgri_GH10546
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dgri_GH10546
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH10546
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dgri_GH10546
   00982 Drug metabolism - cytochrome P450
    Dgri_GH10546
   00983 Drug metabolism - other enzymes
    Dgri_GH10546
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dgri_GH10546
Glycosyltransferases [BR:dgr01003]
 Others
  Hydrophobic molecule
   Dgri_GH10546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 520 aa AA seqDB search
MLLLRSLLLLPALLLALLQVRVEAGRPLKVLGLFPHPGVSHFHFFQPLMQALAEAGHDVH
VVSHFPLKNPTVRYKDYPLTGMDKLTNSVDLKMFDNRAFYTLYFEFFMLYEWGKQACNLT
LRSDALHEVLRRRAGYYDVIIVEQFNSDCMMGVAHQLQAPVIALSSSAMMPWYFENMGVP
IIPSYIPCLFLGQSQDMNFVGRFANWITFHSFNLMYKMFSIPAADALVQYKFGHETPSVG
KLAKNTSVFFVNQHYALSGPKPLPPNVIELGGLHIQKAKPLSDELQRLLDNAEHGVIVIS
WGSMIRANSLSADKRDGIVRAATRLRQQVIWKWENETLPNKPPNMHVMEWLPQRDILCHP
NVKVFMTHAGLMGSTEAAYCGVPVVATPMYGDQFLNAAALVQRRMGVLLHYEDINENTVM
RAIRRALDPKHMQAAKLVSHSFNHRPLESMRKALWWVEHVAHTNGNPLLKPSSVEMSRFV
YYSLDCYLALGLILGIVIGSWIILIRSCCGKRPDRKTKKD
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgctgcgttcgctgctgctgctgccagcgttgctgctggcgctgttgcaagtt
cgagtcgaagccggtcgaccgctgaaagttctcggattgtttccacatcccggtgtcagt
cactttcacttcttccaaccactgatgcaagccttggccgaggctggacatgatgtccac
gttgtcagtcattttccgctgaaaaaccctaccgtacgctacaaggattatccgcttaca
ggcatggataaactaacaaatagcgtggacctgaagatgtttgacaatcgcgctttctac
actctttattttgagtttttcatgctgtacgagtggggcaagcaggcttgcaacttgacg
ctgcgctcagatgctttgcatgaggtgctgaggcgcagggctggctactatgacgtcatc
atcgtggaacagttcaactcggattgtatgatgggcgtcgcacatcagctccaggcgcca
gtcattgccctgagcagctccgccatgatgccctggtatttcgagaatatgggcgtaccc
ataataccctcatatataccctgcttgtttttgggccagtcgcaggacatgaactttgtc
ggtcgcttcgccaattggatcacatttcactccttcaacttgatgtacaagatgttttcc
atacccgccgctgatgcactggtgcagtacaaattcgggcacgagacaccctcggtgggt
aagctggcgaagaatacgtccgttttctttgtgaatcaacactatgcgctgagcggcccc
aagccactgccgcccaacgttattgagctgggtgggctgcacatacagaaggccaagccg
ttgagtgacgaactgcaacggttgctggacaatgccgagcacggagtgatcgtcatcagt
tggggttccatgatacgcgccaattccctgtcggcggacaagcgggatggcatcgtgcgc
gccgctacccgactgaggcagcaggtcatctggaagtgggagaacgagacgctgcccaac
aagccacccaatatgcatgtcatggagtggctgccacaacgcgatatactctgtcatccc
aatgtgaaggtgttcatgacgcatgcgggtctaatgggctccaccgaagcggcatattgt
ggtgtgcccgttgtggcaacgcccatgtatggcgatcagttcctcaatgcggccgcgttg
gtgcaacgtcgtatgggtgtgctgctccactacgaggacattaacgagaataccgttatg
agggcaataaggcgtgccctggaccccaaacatatgcaggctgccaagttagtttcgcac
tccttcaaccatcgacccttagagtccatgcggaaggccctgtggtgggtggagcatgtg
gctcataccaatggcaatcccctgctgaagcccagttcagtggagatgtcacgtttcgtc
tactactcactggactgctacctcgccttgggtctcattctgggcattgttattggcagt
tggattattttaatccgttcctgctgtggcaaaagaccggatcgtaagaccaagaaggat
taa

DBGET integrated database retrieval system