KEGG   Drosophila grimshawi: Dgri_GH10584Help
Entry
Dgri_GH10584      CDS       T01061                                 

Definition
GH10584 gene product from transcript GH10584-RA
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
dgr  Drosophila grimshawi
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Phototransduction - fly
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dgr00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dgr04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dgr04070]
Organismal Systems; Sensory system; Phototransduction - fly [PATH:dgr04745]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1315 aa AA seqDB search
MMSAGGTYISTASVEVPQALQDGEKFIKWDDDSGSGTPVTMRVDAKGFYLHWIDQNNELD
ILDIATIRDVRTGQYAKKPKDAKLRQIVTMGPQDTLEEKTVTICYGSDFVNMTFVNFCCT
RRDIAQIWSDGLIKLAYSLSQLNGSANMFLLKAHTKLCLQVDKSGRIPVKNIIKLFAQNK
EDRKRVEKALDVTGLPSGKVDSISVSKFQFEDFYNLYKYLTQRSEVERLFDSIVGNSKRK
CMSIAQLVEFLNKTQRDPRLNEILYPYANPARAKELIQQYEPNKFNAQKGQLSLDGFLRY
LMGDDNPIMAPNKLDLCDDMDHPMSHYFINSSHNTYLTGHQITGKSSVEIYRQCLLAGCR
CVELDFWNGRTEEPVIVHGYTFVPEIFAKDVLEAIAECAFKTSEYPVILSFENHCNPRQQ
AKIANYCREIFGDMLLDKPLDSHPLEPNADLPPPSMLRRKIIIKNKKKHHHHHHHHHKKP
SALGTPAAGNKLTSANSVDAAAKAAAAANAQQVAAAAQDEAGAGAAAAGRTMTGAANGDI
VSGGHAPPLQQIRQSSKDSTGSSDSDSSSEDESLPNTTPSLPSGNEPQPDKAQKETEAGA
EISALVNYVQPIHFSSFESAEKKGRCYEMSSFDEKQAMTLLKDRPIEFVNYNKHQLSRVY
PAGTRFDSSNFMPQVFWNAGCQLVALNFQTLDLAMQLNLGIFEYNARSGYLLKPEFMRRS
DRRLDPFAESTVDGIIAGTVSITVLSGQFLTDKRVNTFVEVDMFGLPADTVRKKFRTKTV
RDNGMNPVYDEEPFVFKKVVLPELASMRIAAYEEGGKLIGHRVLPVIGLCPGYRHVNLRS
EVGQPIALASLFLCVVVKDYVPDDLSNFAEALANPIKYQSEQEKRGMQLSVLTDGTDAVA
NADDDLTKSFVFVKVGHQKKELIPVPQTTSPKPRPSISVQATISVDLPSDRTDGQRNDDS
SIAILQHESSLDASGSTSLRQVDTSQFDVNRVFAEPLDKILEHKSVREKRLEMEKKLESL
RKKHDKEKLKIAGQKSSPLDGGKKPKFTITNKLVKRLSNRSLNCFSTYSEPGVEVPACPI
DLGDSSEESAGAADEAASSSMEGSVSSRLRHACREYTTQYRDLQEKYHEAIYTAAEKVLK
NSQASQMKQMKASLDKEAGEVMHQLQEARRNEVKKIAAVHKDRDELVRMKREVRSSVVER
GVAERTRLKQTFESRTNELQKHHDAVRFELDLHRSRARQILDKDAESRSCVSNNGFLVLF
HAPHHHSCPASRPLSGNNLSLNLDGGACGGAVGGGAGLAISPAKSHNSITAEMKT
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgccgggggcacctacatatcgacggccagcgtggaggtgccacaggccctg
caggatggcgagaagttcatcaaatgggacgatgattccggcagcgggacaccggtgaca
atgcgtgtggatgcaaaaggattctatctccattggatcgatcaaaacaatgagctcgac
attttggatatagccacaatacgcgatgttcgcaccggacaatatgctaagaagccaaag
gacgctaagctgcgccagattgtgacaatgggaccgcaggatacactggaggagaagacc
gtcaccatttgctatggctctgattttgtcaacatgacatttgtcaacttctgctgcaca
cgacgggacattgcccagatctggtcggatggcctcatcaaactggcctacagtctgtcc
cagctaaatggctcggcgaatatgtttctgttgaaggctcacacaaaactctgtctgcag
gtggacaaaagcggacgcataccagtgaaaaacatcattaaactttttgcacaaaataaa
gaggatcggaaacgtgtggagaaggcgctggacgtgaccggcttgccatcgggcaaagtc
gatagcatatcggtgtcgaaatttcaatttgaggacttttacaatttgtacaaatatctg
acgcagcgttccgaggtggagcgcttattcgatagcatcgtgggtaactcgaagcgcaag
tgcatgtccatagcgcagctggtggaatttctgaacaagacgcaacgcgatccgcgtctt
aatgagatactctatccctatgcgaatccggcgcgcgccaaggagctcatccagcaatac
gagcccaacaaattcaacgcacaaaagggccaactcagtttggatggctttttaaggtat
ctcatgggcgatgataatccaataatggcgcccaataagcttgatctctgcgatgatatg
gatcatccgatgtcgcactacttcatcaactcatcgcataacacctacctaacgggccat
cagataacgggcaaatcctccgtggagatatacaggcaatgcctgctcgctggctgcaga
tgcgtcgaactggacttttggaatggacgcaccgaggagccggtcattgtccatggctac
acatttgtgcccgaaatctttgccaaggacgtgctcgaggcaatcgcggagtgcgcattt
aaaacatccgaataccctgtgatattgagtttcgagaatcactgcaatccccggcaacag
gcaaagattgccaactattgccgcgaaatctttggcgatatgctgttggacaaaccgctc
gattcgcatccgctggagccaaatgcggacttgccgccaccatcgatgctgcggcgcaag
atcattatcaagaacaagaagaagcatcatcatcatcatcaccatcatcacaagaaacca
tcggcattgggcacaccagctgccggcaataaactcacatcggcaaactcagtggatgcg
gcggcgaaggctgcagcagctgccaatgcgcaacaagtggctgccgcagcgcaagacgaa
gcaggagctggggcggcagcagcaggacgcacaatgacaggcgccgcaaatggtgacatt
gttagcggaggacatgcgccgccgttgcaacaaatacgtcagagctcaaaggatagcacc
ggctcctccgactcggacagttcgagcgaagatgaatccctgcccaatacaacacccagt
ctgcccagtggcaatgaaccacaaccggataaggcgcaaaaggaaacggaggcgggtgca
gagatctcagcgttagtcaactatgtgcaacccatacactttagctcctttgagtcagcg
gagaagaagggccgctgctatgagatgtcctcgttcgatgagaagcaggcgatgacactg
ctcaaggatcgaccgattgagttcgtcaactacaacaagcatcagttgtcgagagtttat
ccggctggcactcgattcgatagctccaattttatgccgcaggtgttctggaatgccggc
tgtcagctggtggcactgaactttcagaccctcgatctggccatgcaactgaatctgggc
atctttgagtacaacgcccgctccggttatttgttgaagccggagttcatgcgacgctcc
gatcgtcgcctcgatccatttgccgagagcaccgtggatggcattattgccggcaccgtt
tcgattaccgtattatccgggcaattcctcaccgataagcgcgtgaacacctttgtcgag
gtggacatgtttggcctgccggcggatacggtgcgcaagaagtttcgcaccaagactgtg
cgtgacaatggcatgaatcccgtctacgacgaggagccgttcgtcttcaagaaggtggtg
ctgccggagctggcgagcatgcggatcgctgcttatgaggagggtggcaagctgatcggg
catcgggtgctgcccgtgattggtctctgtcccggctatcgtcatgtgaatctccgctcc
gaggtgggtcagccgattgcgctcgcctcgctcttcctgtgcgtcgtcgtcaaggactat
gtgcccgacgatctatccaatttcgccgaggctctcgccaatcccatcaaataccagagc
gagcaggagaagcgcggaatgcagctgtcggtgctgacggatggtacggatgccgtcgca
aatgccgatgacgatctgaccaagtcattcgttttcgttaaagtaggtcaccaaaagaag
gagctaattccggtgccgcaaaccacatcgcccaagccacgtccaagcatctccgtacag
gccaccatcagtgtggatctgccgtcagatcgcacggacggacaacggaacgatgatagc
agcattgccattctacagcacgaaagctcgttggatgcatcgggcagcacatcgctcaga
caggtggatacctcacagttcgatgtgaatcgcgtgttcgccgagccgctggacaagata
ctcgaacacaagtcggtgcgcgagaaacgactagagatggaaaagaaactggaatcgttg
cgcaagaagcacgacaaggagaagctcaagatcgctggccagaagtcgagtcccctcgac
ggcggcaagaagcccaaattcaccatcaccaacaagctggtgaagcgtctgagcaaccgc
agccttaattgtttctctacgtacagtgagccgggtgtcgaagtgcccgcctgccccatc
gatctgggcgacagcagcgaggagagcgccggtgccgcagatgaggcagcatccagcagc
atggagggatcagtcagctcccgtttgcgccacgcctgccgggagtataccacacagtat
cgggacctgcaggagaagtaccatgaggccatctacacagcggccgagaaggtgctgaag
aactcgcaggcgagccaaatgaaacagatgaaggcttcgctggacaaggaggccggtgag
gtgatgcatcagttgcaggaggcgcgacgcaatgaggtcaagaagatcgcagcggtgcac
aaggatcgcgacgagctggtcagaatgaaacgcgaggtgcgcagctctgtggtggaacgt
ggcgtcgcggaacggacgcgcctcaagcagaccttcgaaagccgcacgaatgagctgcag
aagcatcacgatgcggtgcgcttcgaactcgacttacatcgctccagggcccgtcaaata
ctcgacaaggacgctgaatctcgcagctgtgtctccaacaatggcttcctggtgctcttc
catgcaccgcaccatcacagctgtcccgcatcccgaccgctctctggcaataatctctca
ctcaatttggatggtggtgcctgcggtggtgctgtcggtggcggtgcaggacttgccatc
tcgccagccaagtcgcacaatagcattacggcggagatgaagacgtaa

DBGET integrated database retrieval system