KEGG   Drosophila grimshawi: Dgri_GH10596Help
Entry
Dgri_GH10596      CDS       T01061                                 

Definition
GH10596 gene product from transcript GH10596-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 729 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSSSRLDLPQLCNVGRRLDGHINSNNNNSSNHVNEMTTT
QNGNGSNMNNNNNNNLGSPVSCSTTNSSSGNERGSSTKSNSSSGSGSSGNSASSTGSAEL
KCNTPMTPLELVKKYRNYLTDLECEELKVYKEVWYFGQHASKNYNRPAPTANTTNLGYDD
DNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVV
ELNILDELREKDADGSHNVIHMLDYTYFRRHLCITFELMSLNLYELIKKNNYNGFSMSLI
RRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQS
RFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVL
ISVARRRRLFFDSRDAPRCITNTKGRKRAPGSKSLSQILHCQDRYFIDFLQRCLEWDPAE
RMTPDEAAHHEFLQPSASSRHRSCRMSTSSSSSGLNSVSQKSSCYNFAEISPGSGPVVAS
ITSTTAVSNAAITTKSSSSSRQPHSHAQSNGHLPDIKLSASDKYNSMQKVAVRSKITSSV
SDLESVQQYSLHRIYGGIGSGSTHHVSSAATRKHLNGNPSVVGVGGNVSNSSKYGSSTLA
HNHHNVTHHNASTATIATATHHHHHHGIAVGQQSGLGGVSQQGGVGANVAMSHSQSTGDV
SDRAIFGRA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgtgaaatgcctatacaattggacaacgagaagctgcggcgcgatgtg
cgtctgtccagctcgcgcctggacttgccacagttgtgcaatgtcggacgtcgtctcgat
gggcacattaacagcaacaacaacaacagcagcaatcatgttaacgagatgacaacaaca
cagaatggcaatggcagtaacatgaacaacaacaacaacaacaaccttggctcgccggtc
tcctgctcgaccacaaacagcagcagtggcaacgagcgtggctcctcgaccaaatcaaac
agcagcagtggcagcggcagctcgggcaactcggcaagcagcactggcagtgccgagctc
aaatgcaacacgcccatgacacctttagagctggtcaaaaaatatcgcaattatttgact
gacctggagtgtgaggagctgaaggtgtacaaggaggtctggtattttggccagcacgcc
agcaagaactacaatagacccgccccgacagccaataccacaaatttgggctatgacgat
gataatggcaattacaagatcattgaacacgatcatatagcctttcgctacgagatcttg
gaggtgattggcaaggggagctttggccaggtgatcagagcacttgatcacaagacaaac
acacacgttgccatcaaaatcataaggaacaagaagcgtttcctcaaccaggcagtcgtt
gagcttaacatactcgatgagttgcgcgaaaaggatgccgatggatctcataacgtaata
cacatgctggactatacatatttccgtagacatttgtgcattaccttcgagctaatgagt
ttgaatctctacgagctgatcaagaagaataactataatggtttcagcatgagtttaata
cgacgcttctgcaattcgattgtgaaatgcctgcgtttgctctacaaagagaatatcata
cactgtgatctcaagccggaaaacattttgctgaaacaacgcggcagcagctcgattaaa
gtcatcgattttggcagctcgtgctatgtggaccggaaaatctatacatacatccaatcg
agattctatcgctccccggaggtgatacttggactgcaatatggcaccgccattgacatg
tggagcttgggctgcattttggctgagctatatacgggcttcccactgtttcccggcgag
aacgaggtggagcagctggcctgcattatggaggtgctgggtctgccacccaaggtgctc
atctcggtggctcgtcgtcgtcgcctgttcttcgattcgagagatgcgccacgttgcatt
acgaatacgaagggcaggaaacgtgcgccgggcagcaagtctctgtcacagatactgcac
tgtcaggatcggtattttattgactttctgcagcgttgcttggaatgggatcctgcggag
cgtatgacgccggatgaggcggcgcatcatgagttcctgcagccatccgcgtcgagtcgc
catcgcagttgccgcatgtccacgagctcctcgagctccggactgaacagtgtctcccag
aaatcctcctgctacaactttgcagagatctcgcccggcagcgggccagtggtggcctca
atcacgagcaccacagctgtgagcaatgcagccataacgaccaagtccagctccagttcg
cgtcagcctcactcccatgcccagtccaatggacacctgcccgacatcaagctgagcgcc
agcgacaaatacaacagcatgcagaaggtggcggtccgctcgaagatcacgtcgagcgtc
tcggatctggaatcggtgcagcagtattcgctgcatcgcatctacggtggcattggcagc
ggcagcacacatcacgtctcctcggcggcgacccgcaagcatctgaatggcaacccaagc
gttgttggtgtcggtggcaacgtcagcaacagcagcaaatatggcagcagcacgctggcg
cacaatcatcacaatgtcacgcatcacaatgcctccacggcaaccatagcgacagcaacg
catcatcatcatcaccatggcatcgctgttgggcagcagagtggtttgggtggggtgagc
cagcagggcggcgttggcgctaatgtggccatgtcgcattcacagtccaccggtgatgtt
tccgatcgagccatctttgggcgtgcttga

DBGET integrated database retrieval system