KEGG   Drosophila grimshawi: Dgri_GH10622Help
Entry
Dgri_GH10622      CDS       T01061                                 

Definition
GH10622 gene product from transcript GH10622-RA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dgr  Drosophila grimshawi
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH10622
Enzymes [BR:dgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Dgri_GH10622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 272 aa AA seqDB search
MATTAAAVAATSVVVLDRGNNTTCTINLHGATVVSWRVNNQEQLFVSKLASFDGKKAIRG
GIPFVFPQFGPWSFGPQHGFARITRWHLDRAPERLHNGDVEAIFSLMDNEFTRSIWNYQF
RITYRLILREKELHFHIGVYNPSKDLSFTFNMLLHTYLKVPDEGREVVTVNEWTDRIYQH
TPQEHVITNVVSGRKMRLHKYNFPDTVIWNPWIDRSREMSDFGDDEFPNMLCVEAGNVSA
PVILLPGTCFEASQILQIIIEGNVSRKTKRNR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccacgactgcggctgccgtggcagcgaccagtgttgttgtattggatcgtggcaat
aatacgacatgcacaatcaacttgcatggtgccacagttgtgtcctggcgtgtaaataat
caggagcagttgttcgtgagcaagctggcctcctttgatggcaagaaggcgatacgtggt
ggcataccctttgtctttcctcaatttggaccgtggtcctttggtccacagcatggtttt
gcgcgtataacacgctggcatctggatcgggcaccggagcggctgcacaatggcgatgtg
gaggccatattctcgctaatggacaacgagttcacgcgctccatatggaactatcaattt
cgcatcacctatcggctgatattgcgtgagaaggaattgcactttcacattggcgtctat
aatcccagcaaggatctgagcttcacattcaacatgttgctccacacgtatctcaaggtg
ccagatgagggacgcgaggtggtcactgtgaatgagtggaccgatcgaatctatcagcat
acgccgcaggagcatgttattaccaatgtggtttccggccgcaagatgaggctgcacaaa
tacaattttccagatacggtaatttggaatccgtggattgatcgatcgcgcgagatgagt
gactttggtgacgacgaattccccaacatgttgtgcgtggaggcgggcaatgtcagcgca
ccagtcatcctgctgcctggcacctgtttcgaggccagtcagattctacagatcatcatt
gaaggcaatgtgagtcgcaagaccaaacgaaatcgctag

DBGET integrated database retrieval system