KEGG   Drosophila grimshawi: Dgri_GH10713Help
Entry
Dgri_GH10713      CDS       T01061                                 

Definition
GH10713 gene product from transcript GH10713-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dgr  Drosophila grimshawi
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dgr00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dgr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:dgr00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:dgr00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dgr00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dgr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 680 aa AA seqDB search
MSNATAGGGGGFRCTRKMTLAMSGCVIILVIALTVGLCVGLSGDNGVAEGQDGPAFSIDH
VANTFLMNGKPFRYVSGSFHYFRALPDAWRSRLRTMRASGLNALDTYVEWSLHNPHDGEY
DWEGIADIVRFLEIAQEEDFYIVLRPGPYICAERDNGGLPHWLFTKYPDIKVRTNDPNYI
AEVGKWYAQLMPRLKHLLFGNGGKIIMVQVENEYGAYHACDHDYLNWLRDETDKYVENKA
LLFTVDIPNERMHCGKIDNVFATTDFGIDRIFEIDKIWELLRGIQPTGPLVNSEFYPGWL
THWQEMNQRRDGKEVADALKKILSYGASVNLYMFFGGTNFGFTAGANYDLDGGIGYAADI
TSYDYDAVMDEAGGVTNKYELVKQVIGEVLELPDITLNPAKRLSYGTVELTPALELLSAE
GRAALSKGTPVKSDQPKSFEEMDQYSGLLLYETTLPSMDLDPSLLKVEELRDRAHVFVDQ
QLVGTLSREARIYALPLSKGWGSTLQLLVENQGRINYDRANDTKGIFGKVTLQLHNGGAL
SLDGWTTTGYPLEAYAIETWRKDAAALDPSIAKQRLLRTGPIAYTGSFEVTEVGDTYLNT
AGWGKGVAYVNGFNLGRYWPLGGPQITLYVPNELLKVGQNSVVLLEYQRCNKTSNGSELP
AVQFDAVAQLDGESSEASLK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgccacagctggtggcggcggcggttttcgctgcactcgcaagatgacatta
gcgatgagcggctgtgtgataattttggtgatcgcgttgacagtcggcctctgcgtgggt
ctcagcggcgacaatggcgtcgcagaggggcaggatggtcccgccttcagcatcgatcat
gtggcaaacacatttcttatgaatggaaaaccatttcgttatgtctccggatcgtttcac
tattttcgtgccctgcccgatgcctggagaagtcgcttacgcaccatgcgagcatctggt
ctgaatgcattggatacctacgttgaatggtcgctgcacaatccacacgatggcgaatac
gactgggagggcatagccgatatagttcgatttctggaaattgctcaagaggaggacttt
tatattgtgcttcgtcccgggccctacatctgtgccgagcgagataacggaggcctacca
cactggctattcacaaaatatccagacattaaagtgcgcaccaacgatcccaactacatt
gcggaggtgggcaagtggtacgcacaattgatgccgcgtctgaagcatttgctatttggc
aatggtggcaagatcataatggttcaggttgagaatgaatatggtgcgtaccatgcctgc
gatcatgactatctgaactggctgcgcgatgagactgataaatatgtggagaacaaggcg
ctattgtttacggtggacatacccaatgagaggatgcactgcggcaagattgataatgta
tttgccaccacggactttggcatagatcgcatatttgagatcgacaaaatttgggaacta
ttgcgcggcatacagccgacgggaccgttggtcaactcggagttctatcctggttggctg
acgcactggcaagagatgaatcagcgacgcgatggaaaggaggtggccgacgctctaaag
aagatactcagctatggtgccagcgttaatctctacatgttctttggtggcaccaatttt
ggcttcacggccggcgccaattatgacttggatggaggcataggctatgcagcggatata
accagctatgactacgatgcggtcatggatgaggctggcggagtgaccaacaaatatgaa
ctggtcaagcaagtgataggagaagtcctcgaattgcccgacataacactaaatccagcc
aagcgtttgagctatggcacagtggagctgacgccagcattggagttgctctcggcagag
ggacgcgctgctctatctaaaggcacacccgtgaagtccgatcagcccaaatcattcgag
gagatggatcagtattccgggctgctgctctatgagacaacgttgcccagcatggatcta
gatccatcattgctaaaggtggaggagctgcgagatcgtgcacatgtctttgtggatcaa
cagctggttggcacactgtccagggaggcgcgtatttatgccctgcccctgagcaagggc
tggggcagcacactgcagctgctggtggagaatcagggacgcatcaactacgatcgcgcc
aacgatacgaaaggcatctttggcaaggtgacgttgcagttgcacaatggcggtgcttta
tcactggacggctggacaacgactggctatccactggaagcgtatgccatcgagacatgg
cgcaaggatgctgcagccctagatccatccattgccaaacagcgtttgttacgcactggt
cccattgcctatacgggcagttttgaggtaaccgaagtgggcgatacttatctcaatacg
gccggctggggcaaaggtgtggcctatgttaatggtttcaacttgggacgctactggccg
ctgggtggtccacaaattacgctctatgtgcccaacgagctcctcaaagtgggccaaaac
tctgtagtactactcgagtatcagcgctgcaataagacaagcaacggttcagagctgcct
gcagtgcaatttgatgcagtggctcagctggatggagagtctagtgaggcatcgcttaaa
tag

DBGET integrated database retrieval system