KEGG   Drosophila grimshawi: Dgri_GH10716Help
Entry
Dgri_GH10716      CDS       T01061                                 

Definition
GH10716 gene product from transcript GH10716-RA
Orthology
K05759  
profilin
Organism
dgr  Drosophila grimshawi
Brite
Exosome [BR:dgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dgri_GH10716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVNKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQQDLLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtcgataatcaacttttggcctcgcagtgcgtcaacaaggcc
tgcattgccggacacgatggcaacatttgggcgcagtccaatggctttgaggttacaaag
gaggagctggccaaattgattagcggatttgatcagcaggacctgcttaccagcaacggc
gtaacattagccggtcaacggtacatttacctctcaggcacagatcgcgtagtgcgcgca
aaacttggcagaagcggtgtgcactgcatgaagacgacacaagccgtcatcgtttccatc
tacgaggatcctgtacagccccagcaggccgcttccgtggtggagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system