KEGG   Drosophila grimshawi: Dgri_GH10716Help
Entry
Dgri_GH10716      CDS       T01061                                 

Definition
(RefSeq) GH10716 gene product from transcript GH10716-RA
  KO
K05759  
profilin
Organism
dgr  Drosophila grimshawi
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dgri_GH10716
Cytoskeleton proteins [BR:dgr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dgri_GH10716
Exosome [BR:dgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dgri_GH10716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVNKACIAGHDGNIWAQSNGFEVTKEELAKLISGFDQQDLLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaagattatgtcgataatcaacttttggcctcgcagtgcgtcaacaaggcc
tgcattgccggacacgatggcaacatttgggcgcagtccaatggctttgaggttacaaag
gaggagctggccaaattgattagcggatttgatcagcaggacctgcttaccagcaacggc
gtaacattagccggtcaacggtacatttacctctcaggcacagatcgcgtagtgcgcgca
aaacttggcagaagcggtgtgcactgcatgaagacgacacaagccgtcatcgtttccatc
tacgaggatcctgtacagccccagcaggccgcttccgtggtggagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system