KEGG   Drosophila grimshawi: Dgri_GH10739Help
Entry
Dgri_GH10739      CDS       T01061                                 

Definition
GH10739 gene product from transcript GH10739-RA
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Dgri_GH10739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 683 aa AA seqDB search
MASEQTPMDGAGAGAAAAVAGDEPFLGLLDVALLAVLIGGAAFYFLRSRKKEEEPVRSYS
IQPTTVCTTTATDNSFIKKLKTSGRSLVVFYGSQTGTAEEFAGRLAKDGIRYRLKGMVAD
PEECDMEELLQLKDIENSLAVFCLATYGEGDPTDNAMEFYEWITSGDVDLTGLNYAVFGL
GNKTYEHYNKVAIYVDKRLEELGANRVFELGLGDDDANIEDDFITWKDRFWPAVCDHFGI
EGSGEEVLIRQYRLLEQPDVQPDRIYTGEIARLHSMQNQRPPFDAKNPFLAPIRVNRELH
KGGGRSCMHIELNIDGSKMRYDAGDHVAMYPINDKSLVEKLGQLCSADLDTVFSLINTDT
DSSKKHPFPCPTTYRTALTHYLEITAIPRTHILKELAEYCTDEADKQLLRSMASLTPEGK
EKYQSWIQDACRNVVHILEDIKSCRPPLDHVCELLPRLQPRYYSISSSAKLHPTDVHVTA
VLVEYKTPTGRVNKGVATTYLKNKQPTNGGEEVKVPVFIRKSQFRLPTKPETPIIMVGPG
TGLAPFRGFIQERQYLRDEGKTVGESVLYFGCRKRSEDYIYEAELEEWAKKGTLTLKTAF
SRDQAKKIYVQHMLEQDADLIWDVIGEKKGHFYICGDAKNMAVDVRNILTKILSTKGSMS
EAEAVQYLKKMEAQKRYSADVWS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgagcagacaccgatggatggagccggagctggagcagctgctgctgttgct
ggggatgaaccgtttttggggctgctcgatgtggcactgctggcggtgctgatcggtggt
gctgcattttatttcctgcgcagccgcaagaaggaggaggaacccgttcgcagctattcc
atccagccaaccacagtgtgcacaacgacagcgacggataattcgttcatcaagaaactg
aaaacctccggtcgtagtctggtcgtcttctatggctcacagacgggcaccgctgaggaa
tttgctggtcgattggccaaggatggtatacggtatcggttgaagggcatggttgccgat
cccgaggaatgcgatatggaggaactgctgcagctgaaggatatcgaaaactcattggcc
gtcttctgcctggccacctacggcgagggtgatcccaccgacaatgccatggagttctac
gaatggatcaccagcggtgatgtcgatctaacaggcctcaattatgcggtatttggtctg
ggcaacaagacttacgagcactacaacaaagttgccatctatgtggacaagcgattggag
gagctcggcgcgaatcgcgtcttcgagctgggactcggcgatgatgatgccaacattgag
gatgactttatcacgtggaaggatcgcttctggcccgccgtctgtgatcactttggtatt
gagggcagcggcgaggaggtgctgatacgtcagtatcgtttgctcgaacagcccgatgtg
cagccggatcgcatctatactggcgagattgctcgattgcattccatgcagaatcagcgg
ccgccattcgatgccaagaatccattcctggccccaattcgtgtcaatcgtgaactgcac
aagggcggcggtcgctcgtgcatgcacatcgagctgaatattgatgggtcgaagatgcgc
tatgatgccggtgatcatgtggccatgtatcccatcaatgacaagtcgctggtggagaaa
cttggccagttgtgcagtgccgacttggatacagtcttctcgctgatcaacaccgatacg
gacagcagtaagaagcatccgttcccatgccccaccacttatcgcacggcgctgactcac
tacttggaaatcacggccattccacgcacgcacatcctcaaggagctggccgaatactgc
acggatgaggcggataagcagctgctgcgcagcatggcttcgctgacgccggagggtaag
gagaagtatcagagctggatacaggatgcgtgtcgcaatgtcgtccacatactggaggat
atcaagtcatgtaggccgccattggatcatgtttgcgagctgttgcctcggctgcagccg
cgctactattcgatatcgtcgtcggccaagctacatccaacggatgtgcatgtgaccgct
gtgcttgtcgagtacaagacgcccacgggtcgtgttaataagggcgtggccaccacttac
ctgaaaaacaaacagcccacaaatgggggcgaggaagtcaaggtgccggtcttcatacgc
aaatcacaattccggctacccacaaaaccggagacgcccattataatggtgggtccgggc
acgggtctagcaccgttccgtggtttcatccaggagcgtcagtatttgcgcgacgagggc
aaaacggtgggggagtcggtgctgtattttggctgccgcaagcgcagcgaggactacatt
tacgaggctgagctggaggagtgggccaagaagggcacactcacgctgaagacggccttc
tcgcgcgaccaggccaagaagatctacgtgcagcatatgctcgagcaggatgcagatctg
atttgggatgtgattggcgagaagaaaggacacttttacatttgcggcgatgccaagaat
atggctgtggatgtgcgaaacattctgaccaaaattctgtccaccaagggcagcatgagt
gaggcggaagccgtgcagtatctgaaaaagatggaagcccagaagcgttactcggccgat
gtctggagctaa

DBGET integrated database retrieval system