KEGG   Drosophila grimshawi: Dgri_GH10948Help
Entry
Dgri_GH10948      CDS       T01061                                 

Definition
GH10948 gene product from transcript GH10948-RA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dgr  Drosophila grimshawi
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dgri_GH10948
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dgri_GH10948
    2.7.1.82  ethanolamine kinase
     Dgri_GH10948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 577 aa AA seqDB search
MRERKRVNNKQKSRRQNQQKLQGIDLNCCKRQRCNYEHIWQHFRRNATLEEIRQAASRIC
RDYLTGRWKVATPEQLVVKRISGGLSNFLYYVSLPDLDDFDEQQLLEVEQHQLQQPQPNV
NIGRHVIAASTFAKNSNSYSSTNNNNNNNNESPKLANELAQTVVGGVVAAGAADDDDDVA
LSAKQANKRRRFDSDSGDSSLLRRLHAPPKQEPREVLLRIYGQTHGDHALESMITESVVF
ALLSERNFGPKLHGIFPGGRIEQYISARSLATTEMGDARISMKIAEKMGEIHSLNIPLSK
KPDWIWNCMDRWLASLESIVKGKIESRPSSAVLQKQRELMRTIDYVQEMAWLRSLFDSGD
YPVVFCHNDLQEGNILLRQSNSGQERTPRESISILRSNFDETLGDSLDGNSNLDTDDNKS
HSASPCPELDTTDDSALDSSFMSDHEPDLIIIDFEYCAYNYRGFDLANHFIEWTFDYTNP
QFPYFHHYKEQYATVQQRRDFIVNYLKKYHDDELFEPTMQELDTVDAEIQVFTMLSHLFW
SLWSVVNVTSAIEFGYWEYGIARILEYQQLKSAYLAK
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgagagaacgtaaacgtgttaacaataaacagaaatctcgtcgacaaaaccagcagaaa
ttgcaaggaatcgatctgaattgttgcaagcgacaacgttgtaattatgaacatatctgg
caacactttcgacgcaatgccacactcgaggaaattcgacaggcggcttctcgcatctgc
cgcgactatctaaccggaaggtggaaggtggccaccccggagcagcttgtggtgaagcgt
atcagtggcggcctctcaaatttcctatattacgtaagtctgcccgacttggatgacttt
gatgaacagcaactattggaggtggagcaacaccagctgcagcagccgcaaccaaatgtc
aacattggcagacatgttatagctgcctcgacattcgctaagaatagcaacagctacagc
agcaccaacaacaacaacaacaacaacaacgagtcgcccaagttggctaatgaattggcc
caaacggttgtcgggggcgtcgttgctgctggcgccgcagacgatgatgatgatgtggcg
ctgagcgccaaacaggcaaacaaacggcgacgcttcgatagcgacagcggtgactcaagt
ctgctgaggcgcctgcacgctccccccaagcaggaaccgcgtgaggttctcttgcgcatc
tatggccagacacatggagatcacgcattggagagcatgattaccgaatccgttgtcttc
gccttgctcagtgagcgcaactttggaccaaagctacacggcatctttcccggtggacgc
attgagcaatatatttcggcacgttccttggccacaacagagatgggcgatgcacgcatc
tccatgaagatcgccgagaaaatgggtgaaatccatagcctgaatataccgttgtccaag
aaaccggactggatatggaactgcatggatcgttggctggccagcttggagagcattgtg
aagggcaagattgaatcgaggcccagttcggcggtgctgcaaaagcagcgtgaactaatg
cgcaccattgactatgtgcaggagatggcctggctaagatcgttgttcgattcgggtgac
tatccggtcgtcttctgccacaacgatctgcaggaaggcaacatcctgttgaggcaatcg
aacagtggacaagaacgtacacccagggaatcgataagtatattgagatccaactttgat
gagacactgggcgacagcctggatggcaacagcaacttggatacggatgacaataaatcg
cacagcgcctcaccctgtccggaattggataccacagatgactccgcactggactcgagc
tttatgtccgatcatgagccggatctcattatcattgactttgagtactgcgcttataac
tatcgcggtttcgatctggccaatcacttcatcgaatggaccttcgactataccaatccg
caattcccctatttccatcattacaaagagcaatatgccacggtccagcagcgacgcgac
ttcatagtcaattatctgaagaaatatcacgatgatgagctcttcgaacccactatgcag
gaactcgatacggtcgatgcagagattcaggtcttcaccatgctctcgcatctgttctgg
agtctgtggtcggtggtcaatgttacctcagccattgaatttggttattgggaatatggc
attgcgcgaattctggaatatcagcagttgaagtctgcctatttggcaaaatga

DBGET integrated database retrieval system