KEGG   Drosophila grimshawi: Dgri_GH11027Help
Entry
Dgri_GH11027      CDS       T01061                                 

Definition
(RefSeq) GH11027 gene product from transcript GH11027-RA
  KO
K04659  
thrombospondin 2/3/4/5
Organism
dgr  Drosophila grimshawi
Pathway
Phagosome
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dgri_GH11027
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    Dgri_GH11027
Membrane trafficking [BR:dgr04131]
 Endocytosis
  Phagocytosis
   Opsonins
    Dgri_GH11027
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dgri_GH11027
  Exosomal proteins of colorectal cancer cells
   Dgri_GH11027
  Exosomal proteins of bladder cancer cells
   Dgri_GH11027
Cell adhesion molecules and their ligands [BR:dgr04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Dgri_GH11027
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     Dgri_GH11027
   VNR
     Dgri_GH11027
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   Dgri_GH11027
Glycosaminoglycan binding proteins [BR:dgr00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   Dgri_GH11027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1060 aa AA seqDB search
MNWLRVLLIGVAVLALALVEVASLSLDPVASAELEQYIRKGDVVISTRHIRPRRKLHISI
EALFMIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQFS
KNRITLFVDCKPSTSHDMDMSLTKLYTQMDDPVIKLFRERKYPLHFDADMEHSLQRANCQ
KGLHRRGNRRMLRNKITEREKNKKRDVRSNWYHEPTLARDGVDQRKQEIPTDVERGDIPV
LHGDCEDAFARSLSDLLALVKLLREDVAHQRQEIAYLRVLLENCAGCKEPSGDNHIRLEP
NCRTANPCYPGVDCHETASGPRCGRCPAGYIGDGKSCKPGVSCADRPCFLGVQCHDTVNG
AQCDSCPVGYEGDGRTCSIRNPCLDTPCPSGVECIQLGFPPYFQCISCPRGQKNNRTTCH
DVDECAVYQPCDEIAICKNLNPGFRCGPCPPGFDGIHAHGYSADYLAVGFQKQTCLDIDE
CKMGFFRCPEHSSCHNTIGTYRCQCHDGYVANGTFSCLSIADLCPDGSICARNAECVPID
NYHYQCRCSVGWAGNGRICGRDRDLDGWPDESLNCAEPHCRRDNCPDLPNSGQEDADLDG
IGDGCDEDADSDQVLNSKDNCPFAYNSDQIDSDHDGVGDACDNCIFISNRRQLDSDEDGL
GNECDDDMDNDSMLNQYDNCPLLRNPNQSDMDNDGVGDVCDNCPTIPNPAQEDRDMDLVG
DACDSDIDGDDDGIQDSEDNCPMVSNSDQLDTDADGKGDACDDDMDGDGVPNYRDNCPLA
RNSDQLDLNRNGKGDLCEDDEDEDGTPNIIDNCPNNSMIHRTDFRTIRSVILDPEGDAQL
DPNWEVHANGSEIIQTLNSDPGLVVGSDSFGGVDFEGTFYVNDDTDDDYVGFIFSYQSNR
KFYVVQWKKGTQTYWQSSPFRASAEPGVQIKLIDSNTGPGSMLRNSLWHAGDTPGQAKLL
WRDPLNAGWKEKTSYRWSLVHRPVIGLIRLRIFEGERLILDSHNVYDATLTLKGGRLGVF
CFSQEMIIWSDLVYKCNTRLTPLIYNELPTHLKLKVELEN
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttgcgtgtgctgctaatcggcgtggccgtattggcgctggcactcgttgag
gttgcatcactctcactggatccagttgcctctgccgagttggaacagtatatcaggaag
ggcgatgtggttatatcgacgcgacacataagaccgcgacgcaagttgcatatatccatt
gaggcactgttcatgatcgactttcccatgctgaagcataagatgtccttcttcctcgat
cgcaagcagcagcgggtgacgctggacatcagcgccaatggggcgacagagtcacgcaac
tttgagatacccaacatcaatgagacgagcaccatacgatcgctggccctgcagttctcc
aagaatcgcatcacgctctttgtggactgtaagccgagcacctcccacgacatggacatg
agcctgacaaagctctatacgcaaatggatgatccagttatcaagctgttcagggaacga
aaatatccactgcactttgatgcagacatggagcactcgctgcagcgtgccaactgtcag
aagggtctgcatcgtcgaggcaatcgtcgcatgctgcggaacaagatcaccgagcgtgag
aagaacaagaagcgcgatgttcgcagcaattggtatcatgagccaactctggcccgggac
ggcgttgatcagcgtaagcaggaaatacctaccgatgtggagcgtggtgatatacccgtc
ctgcatggcgattgtgaagacgccttcgcacgatcgctgagcgatcttttggcactggtt
aagctgctgcgtgaagacgtcgcccaccagcgtcaggagattgcctacttgcgcgtgttg
ttggagaattgtgccggctgcaaagagcccagcggggacaatcacatacggcttgagccc
aactgtcgcactgcgaatccttgttatcctggcgttgattgccatgagaccgcctcggga
ccaaggtgcggccgttgtcctgccggctacattggcgatggcaaatcttgcaaaccgggc
gtcagctgtgctgacagaccctgttttctaggcgttcagtgtcacgatactgtgaacggt
gcccagtgtgactcctgtccggttggctatgaaggtgatggacgcacatgttcgatacgt
aatccttgtctggacacaccatgcccctcaggtgttgagtgcattcagttgggctttcca
ccttactttcagtgcatctcctgtccacgtggccagaaaaacaatcgcaccacctgccac
gatgtggacgagtgtgccgtctatcagccctgcgatgaaatagccatttgcaagaatctc
aatccaggcttccgctgtggcccctgtccgcccggatttgatggcattcatgctcatggt
tattcagctgactatctagctgtgggctttcagaagcaaacttgcctggacatagacgaa
tgcaagatgggcttctttagatgtccagaacattcaagctgtcacaataccattggcacc
taccgatgccagtgtcatgatggttatgtggccaatggcacctttagctgtctgtctata
gcggatctctgtcccgatggcagcatctgcgcaagaaatgctgaatgtgtgccaatagat
aactatcactatcagtgccgctgcagcgttggttgggcgggtaatggaaggatctgtggt
agggatcgtgacctggatggctggccggatgagtcacttaactgtgcggagccgcactgt
cgccgcgataactgtccagatttgcccaattcgggacaggaggatgctgatttggatggc
attggcgatggctgcgacgaggatgcagatagcgatcaagtgctcaacagcaaggacaat
tgcccgtttgcgtacaacagcgatcagattgactcggatcacgatggtgttggcgatgcc
tgtgacaattgtatttttatttcgaatcgcaggcaactggactcggatgaggatgggttg
ggcaatgagtgtgatgatgatatggataatgattcgatgctgaatcagtatgataattgt
ccactgcttcgcaatccaaatcagtccgatatggataacgatggtgtgggagatgtgtgc
gacaattgtcccacaattccaaatccggcgcaggaggatcgtgacatggatctggtgggt
gatgcctgcgacagtgacattgatggtgatgatgatggtatacaggactcagaggataat
tgtccaatggtcagcaattcagatcaactggacacggatgccgatggcaagggcgatgcc
tgtgacgatgacatggacggcgatggtgtgcccaattacagagacaactgtccactggcc
agaaactctgaccaattggatctgaatcgcaatggcaagggtgacctttgtgaggatgat
gaggatgaggatggcacacccaacatcatcgacaactgtccaaataattccatgatacat
cgcactgattttcgcacaatacgttcggttatattagatccggagggtgatgcacagctg
gatcccaattgggaggtgcacgcaaatggttcggaaataatacaaactctaaactccgat
ccgggactggtggtgggcagtgattcatttggtggggtcgatttcgagggcactttctat
gtcaacgatgatacggacgatgattatgtgggcttcatattcagctatcaaagcaatcgc
aaattctacgtggtgcagtggaagaagggcacacaaacctattggcaatcgtcgcccttc
cgtgcctccgccgagccaggtgtgcagatcaagttgattgatagtaatactggaccaggg
tccatgctgcgcaacagcttgtggcatgccggcgatacgcccggacaggcaaaactgctg
tggagggatccgctaaatgcgggctggaaagagaagacatcatatcgctggtccctggtc
catcgacctgtcattggactcatccggttgcgcatatttgagggcgaacgtttgatactg
gattcgcacaacgtctatgatgccacactcaccctcaagggcggacgtttgggcgttttt
tgcttctcacaggagatgattatatggtcggatctggtatacaaatgcaacacacgccta
acgcccctcatctacaatgagttgcccacacatctgaagctgaaggtggaactggaaaac
taa

DBGET integrated database retrieval system