KEGG   Drosophila grimshawi: Dgri_GH11058Help
Entry
Dgri_GH11058      CDS       T01061                                 

Definition
(RefSeq) GH11058 gene product from transcript GH11058-RA
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00062  Fatty acid elongation
dgr00071  Fatty acid degradation
dgr00280  Valine, leucine and isoleucine degradation
dgr00310  Lysine degradation
dgr00380  Tryptophan metabolism
dgr00410  beta-Alanine metabolism
dgr00640  Propanoate metabolism
dgr00650  Butanoate metabolism
dgr01040  Biosynthesis of unsaturated fatty acids
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
dgr01212  Fatty acid metabolism
Module
dgr_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dgr_M00085  Fatty acid biosynthesis, elongation, mitochondria
dgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dgri_GH11058
   00650 Butanoate metabolism
    Dgri_GH11058
  Lipid metabolism
   00062 Fatty acid elongation
    Dgri_GH11058
   00071 Fatty acid degradation
    Dgri_GH11058
   01040 Biosynthesis of unsaturated fatty acids
    Dgri_GH11058
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dgri_GH11058
   00310 Lysine degradation
    Dgri_GH11058
   00380 Tryptophan metabolism
    Dgri_GH11058
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dgri_GH11058
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dgri_GH11058
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dgri_GH11058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 6561593
NCBI-ProteinID: XP_001988242
FlyBase: FBgn0118539
UniProt: B4JCF5
AA seq 785 aa AA seqDB search
MSALRFLSAVGQISKQQLLNNKCSRAHPFSAQLQRRLMSTNLAPAAAASAQKHLHTKVID
GVMVIKIDSPNVKVNSLGAEVSNEFESVIKDLETNAAVKAAVLISGKPGCFVAGADIGML
EACKSAEDATLISHGGQIFFDRLERSRKPVVAAISGVCLGGGLELALACHYRIATKDSKT
KLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMGLTGKQIRADRAKRMGIVDLLVDPVGP
GQQSAAQNSMDYLERTAIQVANDLASGKLRVNREKSGLVDKLQALVMDTDFVKNKIFDTA
RKQVMKATGGLYPAPLKILEVIRTGVDKGTDAGFEAERKGFGELAATPQSKGLMALFRGQ
TECKKNRFGNPQRAVETVGVLGAGLMGAGIVQVSVDKGYKVIMKDATEPGLARGIGQVQK
GLETAVKRKRITALKRDQVMSMLLPTLNYKDFEKADIVIEAVFEDIQIKHRVIKELEAVV
PEHCIIASNTSAIPITQIAAGSSRPDKVVGMHYFSPVDKMQLLEIITHPGTSKDTVAQAV
AVGLKQGKVVITVGDGPGFYTTRILATMLSEAIRLLQEGVDPKELDQLTKKFGFPVGAAT
LADEVGIDVGSHIAIDLAKAFGERFSGGNQQVMSDLVLAGFLGRKSGKGIFLYDGQTKGS
RPINTEALEIVKQKYSLDSKGANTPEDMTLRLVSRFVNEAVLCLEEKILDSPLEGDVGAV
FGLGFPPFTGGPFRWVDQYGAGKLVSKMQSFAELYGAPFKPSQTLLDMAKDPSKKFYPKT
SDAKL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcattaaggtttctaagtgccgttggccaaatatccaaacagcaattgctgaac
aataaatgctcaagagcacatccattctctgcacaactccagcgacgtctaatgtctacg
aatttagcaccggctgcggctgcttctgcccagaagcatctgcacaccaaagtcatcgat
ggggttatggtgatcaagattgattcacccaatgtgaaggttaattcgctgggcgcagag
gtgagcaacgagttcgagagcgtcattaaggatctagagacaaatgcggctgtcaaagcg
gcagtgctcatttcgggcaaaccgggctgctttgttgcgggcgccgatattggcatgctg
gaggcctgcaagtcagccgaggatgccacactcatctcgcacggtggtcagatcttcttc
gatcgcctggagcgcagtcgcaagcccgttgtggccgctattagcggtgtctgcctgggt
ggcggcctcgaattggcgcttgcctgtcactatcgcatcgccaccaaagacagcaagacc
aagctgggtctgccggaagttatgctcggcctgctgccaggcggtggcggcactgtgcgc
ctgcccaagctgacatcggtgcccactgccttggacatggggctgacaggcaaacagatc
cgtgccgatcgtgccaagcgtatgggtatcgtcgatttgctcgtcgatcccgtcggaccc
ggccagcagtcagcggcgcaaaactccatggactatctggagaggacagccatacaagta
gccaacgatttggccagcggcaaactgcgcgtcaatcgcgagaaatctggcttggtcgat
aagctgcaggcgctcgtcatggacacggactttgtgaagaacaaaatctttgacacagcc
cgcaaacaggtgatgaaggccacgggtggtctctatccagcgcccctcaagattctcgag
gtgattcgcactggagtcgacaagggtaccgatgctggcttcgaagccgagcgcaaaggc
ttcggtgaattggcggccacaccgcaatcgaagggtctgatggcgcttttccgtgggcag
accgagtgcaagaagaatcgctttggcaacccacagcgggcagtagaaactgtgggcgtg
ctgggtgctggcctgatgggcgccggcattgtgcaggtgtccgtggacaagggctacaag
gtgataatgaaggatgctaccgagccgggcctggcacgcggcattggccaggtgcagaag
ggactggagacggctgtgaagcgcaagcgcatcacggcactgaaacgcgatcaagtgatg
tccatgctgctgcccacattgaactacaaggactttgagaaggccgacattgtgatcgag
gccgttttcgaggacatccaaatcaagcatcgtgtgatcaaggaactggaggctgtcgtg
cccgaacactgcatcattgccagcaacaccagcgccatacccattacacagattgcagct
ggtagctctcgtcccgataaagtggttggcatgcattatttctcgccggtggacaaaatg
caactgctggagatcataacgcatccaggcacctccaaggataccgttgcccaggccgtt
gccgttggcctcaagcagggcaaggtggtgatcacggtgggagatggtcccggtttttac
accacacgaattctcgccaccatgttgtcagaggccataagactactgcaagagggcgtg
gatcctaaggaactggaccagctcaccaagaagtttggcttccccgtgggcgctgccaca
ctggccgatgaggtgggcattgatgtgggatctcacattgctattgatttggccaaagca
ttcggcgaacgtttcagcggtggcaatcagcaagtcatgagcgatctggtgttggctggt
ttccttggccgcaaatcgggcaagggcattttcctgtacgatggccaaaccaagggtagc
cgccccataaacaccgaggcactcgaaattgtcaagcagaagtattctttagactccaag
ggcgccaatacgcccgaggatatgaccctgcgcctggtgtcgcgcttcgtgaacgaggca
gtgctgtgcctagaggagaagatactggacagtccgttggagggcgatgtgggcgccgta
ttcggcttgggcttccccccattcaccggcggccccttccgctgggtcgatcagtacggt
gctggcaaattggttagcaaaatgcagtcatttgccgaactatatggtgctccatttaag
ccctcccaaactctgctcgatatggccaaggatccgtccaagaaattctatcccaagact
tctgatgcaaaattgtaa

DBGET integrated database retrieval system