KEGG   Drosophila grimshawi: Dgri_GH11058Help
Entry
Dgri_GH11058      CDS       T01061                                 

Definition
GH11058 gene product from transcript GH11058-RA
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dgr  Drosophila grimshawi
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgri_GH11058
   01212 Fatty acid metabolism
    Dgri_GH11058
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dgri_GH11058
   00650 Butanoate metabolism
    Dgri_GH11058
  Lipid metabolism
   00062 Fatty acid elongation
    Dgri_GH11058
   00071 Fatty acid degradation
    Dgri_GH11058
   01040 Biosynthesis of unsaturated fatty acids
    Dgri_GH11058
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dgri_GH11058
   00310 Lysine degradation
    Dgri_GH11058
   00380 Tryptophan metabolism
    Dgri_GH11058
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dgri_GH11058
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dgri_GH11058
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dgri_GH11058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 785 aa AA seqDB search
MSALRFLSAVGQISKQQLLNNKCSRAHPFSAQLQRRLMSTNLAPAAAASAQKHLHTKVID
GVMVIKIDSPNVKVNSLGAEVSNEFESVIKDLETNAAVKAAVLISGKPGCFVAGADIGML
EACKSAEDATLISHGGQIFFDRLERSRKPVVAAISGVCLGGGLELALACHYRIATKDSKT
KLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMGLTGKQIRADRAKRMGIVDLLVDPVGP
GQQSAAQNSMDYLERTAIQVANDLASGKLRVNREKSGLVDKLQALVMDTDFVKNKIFDTA
RKQVMKATGGLYPAPLKILEVIRTGVDKGTDAGFEAERKGFGELAATPQSKGLMALFRGQ
TECKKNRFGNPQRAVETVGVLGAGLMGAGIVQVSVDKGYKVIMKDATEPGLARGIGQVQK
GLETAVKRKRITALKRDQVMSMLLPTLNYKDFEKADIVIEAVFEDIQIKHRVIKELEAVV
PEHCIIASNTSAIPITQIAAGSSRPDKVVGMHYFSPVDKMQLLEIITHPGTSKDTVAQAV
AVGLKQGKVVITVGDGPGFYTTRILATMLSEAIRLLQEGVDPKELDQLTKKFGFPVGAAT
LADEVGIDVGSHIAIDLAKAFGERFSGGNQQVMSDLVLAGFLGRKSGKGIFLYDGQTKGS
RPINTEALEIVKQKYSLDSKGANTPEDMTLRLVSRFVNEAVLCLEEKILDSPLEGDVGAV
FGLGFPPFTGGPFRWVDQYGAGKLVSKMQSFAELYGAPFKPSQTLLDMAKDPSKKFYPKT
SDAKL
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcattaaggtttctaagtgccgttggccaaatatccaaacagcaattgctgaac
aataaatgctcaagagcacatccattctctgcacaactccagcgacgtctaatgtctacg
aatttagcaccggctgcggctgcttctgcccagaagcatctgcacaccaaagtcatcgat
ggggttatggtgatcaagattgattcacccaatgtgaaggttaattcgctgggcgcagag
gtgagcaacgagttcgagagcgtcattaaggatctagagacaaatgcggctgtcaaagcg
gcagtgctcatttcgggcaaaccgggctgctttgttgcgggcgccgatattggcatgctg
gaggcctgcaagtcagccgaggatgccacactcatctcgcacggtggtcagatcttcttc
gatcgcctggagcgcagtcgcaagcccgttgtggccgctattagcggtgtctgcctgggt
ggcggcctcgaattggcgcttgcctgtcactatcgcatcgccaccaaagacagcaagacc
aagctgggtctgccggaagttatgctcggcctgctgccaggcggtggcggcactgtgcgc
ctgcccaagctgacatcggtgcccactgccttggacatggggctgacaggcaaacagatc
cgtgccgatcgtgccaagcgtatgggtatcgtcgatttgctcgtcgatcccgtcggaccc
ggccagcagtcagcggcgcaaaactccatggactatctggagaggacagccatacaagta
gccaacgatttggccagcggcaaactgcgcgtcaatcgcgagaaatctggcttggtcgat
aagctgcaggcgctcgtcatggacacggactttgtgaagaacaaaatctttgacacagcc
cgcaaacaggtgatgaaggccacgggtggtctctatccagcgcccctcaagattctcgag
gtgattcgcactggagtcgacaagggtaccgatgctggcttcgaagccgagcgcaaaggc
ttcggtgaattggcggccacaccgcaatcgaagggtctgatggcgcttttccgtgggcag
accgagtgcaagaagaatcgctttggcaacccacagcgggcagtagaaactgtgggcgtg
ctgggtgctggcctgatgggcgccggcattgtgcaggtgtccgtggacaagggctacaag
gtgataatgaaggatgctaccgagccgggcctggcacgcggcattggccaggtgcagaag
ggactggagacggctgtgaagcgcaagcgcatcacggcactgaaacgcgatcaagtgatg
tccatgctgctgcccacattgaactacaaggactttgagaaggccgacattgtgatcgag
gccgttttcgaggacatccaaatcaagcatcgtgtgatcaaggaactggaggctgtcgtg
cccgaacactgcatcattgccagcaacaccagcgccatacccattacacagattgcagct
ggtagctctcgtcccgataaagtggttggcatgcattatttctcgccggtggacaaaatg
caactgctggagatcataacgcatccaggcacctccaaggataccgttgcccaggccgtt
gccgttggcctcaagcagggcaaggtggtgatcacggtgggagatggtcccggtttttac
accacacgaattctcgccaccatgttgtcagaggccataagactactgcaagagggcgtg
gatcctaaggaactggaccagctcaccaagaagtttggcttccccgtgggcgctgccaca
ctggccgatgaggtgggcattgatgtgggatctcacattgctattgatttggccaaagca
ttcggcgaacgtttcagcggtggcaatcagcaagtcatgagcgatctggtgttggctggt
ttccttggccgcaaatcgggcaagggcattttcctgtacgatggccaaaccaagggtagc
cgccccataaacaccgaggcactcgaaattgtcaagcagaagtattctttagactccaag
ggcgccaatacgcccgaggatatgaccctgcgcctggtgtcgcgcttcgtgaacgaggca
gtgctgtgcctagaggagaagatactggacagtccgttggagggcgatgtgggcgccgta
ttcggcttgggcttccccccattcaccggcggccccttccgctgggtcgatcagtacggt
gctggcaaattggttagcaaaatgcagtcatttgccgaactatatggtgctccatttaag
ccctcccaaactctgctcgatatggccaaggatccgtccaagaaattctatcccaagact
tctgatgcaaaattgtaa

DBGET integrated database retrieval system