KEGG   Drosophila grimshawi: Dgri_GH11116Help
Entry
Dgri_GH11116      CDS       T01061                                 

Definition
GH11116 gene product from transcript GH11116-RA
Orthology
K03099  
son of sevenless
Organism
dgr  Drosophila grimshawi
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dgri_GH11116
   04630 Jak-STAT signaling pathway
    Dgri_GH11116
   04068 FoxO signaling pathway
    Dgri_GH11116
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dgri_GH11116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1595 aa AA seqDB search
MFSSGGSHGISVGVASTVQDSDGYDFTKNENAARWRGLFIPSLRKVLEQVNPRVTAKEDA
LHYVENLCVRLLAKLCAKPLPHSVQDVEEKVNKSFPAPIDQWALKEANEVINSKKRKSLL
PTERVHTLLQKDVLQYKIDSSVSSYLVAVLECISADILKMAADYVCAMRHSEIAKEDIEV
VLNADGVLLDMLNRSSEQLKCNVLPSPLSLPAQRASATYEETVKELINDEKQYQRDLHMI
IRVFREELLKIARDPKELEPIFSNIIDIYEVTVTLLGSLEDVIEMSQEQNAPCVASCFEE
LAEAEEFDVYKKYAHDVTSQASRDALSNLLAKPDALSLMSAGHGFREAVKYYLPKLLLVP
ICHAFVYFDYIKHFMDLSTSQDDIESFAQVQGLLHPLHCDLEKVLANLSKKRLVPVSGRV
RRQMAIERTRELQLKVEHWDDKDVGLNCNEFIREDSLSKLGSGKRIWSERKVFLFDGLMV
LCKANTKKQTPSAGATAYDYRLKEKFFMRRVEINDRADTDELKHSFELITRIHSVIVLSA
ENAQHKSDWMADLIMVNTKSMLDRILDSILQDIERKHPLRMPSAEIYKFAVPDSAENIVL
EERDSGVVPMIKGATLCKLIERLTYHIYADPTFVRTFLTTYRYFCSPQQLLTLLIERFEI
PEPSLVYQEQQSNHNEHHHDKDASATATVSTADSEKMLKNSQREDWKRYRKEFVQPVQFR
VLNVLRHWVDHHFYDFEKDPTLLDRLLHFLNDVNSKSMRKWVDSVRKIVDRKNKQSNKKI
VYAYGHDPPPIEYHLNVPDEEITLLTLHPLEVARQLTLLEFEMYKNVKPSELVGSPWTKK
DKELKSPNLLKIMKHTTNVTRWIERSIMEAENFDERLAIMQRAIEVMMVMLELNNFNGIL
SIVAAMGTAAVFRLRFTFNALPERHRKFLDECRELSEDHLKKYQERLRSINPPCVPFFGR
YLTNILHLEEGNPDLLTNTELINFSKRRKVSEIIGEIQQYQNQPYCLNEEPTIRHFFEQL
DPFNGLSDKEMSDYLYNESMRIEPRASKTVPKFPRKWPNIPLKSPGIKPRRQNQSNNSSK
LSSNVPVNVEPPMPAAAATTTTTTATTAAVTSSIGEQSPQHNPHAYSVFAPVIIPERNGG
SSWSSVAPHRTPDNGEVAPAPHLPRKPAAHVWTHNSAPADVFSPALAETQPSAAAAAVGA
AAAAAAGGWNNISDCYVISDASSDVLPPSPLPKLMISPRHEATPLPPAPQGSSNRSPFHG
RTAHTQYSPTHSIASTVTLIGGGGSGSGGLGDVSPQLGGFYYNSEQSHGQAAGVPISPHV
NVPTATTLEYRAVPPPLPPRRKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPRLN
HSMAAGYARQPKEFVGRSSSLLLPHTSSIMIRRNSAKQPSLSVNAAAVTGSGLGVTNAAT
AESTGMASDEQLQQPQLLQQPPQSISPALSSSTTTSPMTPMTPMSPYIPSTIDANTSSSY
QQQQQRLRPQQPQTQQSQQQHHHQHHQHHTHTHPHSQHQHSSQHPNRRSSPKEFFSIATS
HEGTPKLPPKPSLSANLYNNPDKGTMFLYPSTNQD
NT seq 4788 nt NT seq  +upstreamnt  +downstreamnt
atgttttccagtggtggcagccatgggattagcgttggcgtcgcctccactgtgcaggac
tcggatggctatgattttacaaaaaacgagaacgcggcacgttggcggggtttatttata
ccatcgctgcgaaaggtgctcgagcaggtgaatccccgtgtgacagccaaagaggatgca
ctgcactatgtggagaatctgtgtgtgcgcctattggccaaattgtgtgcgaaaccactg
ccgcattcagtgcaggatgttgaggagaaggtgaacaaatcgtttccagcgcccatcgat
cagtgggccttgaaggaggccaacgaagtgatcaattcgaagaagcgcaaatctctattg
cccacggaacgtgtgcatacgctgctgcagaaggatgtgctgcagtataagatcgatagc
tcggtctcatcgtatttggtcgctgttctcgagtgcatctcagccgatatactcaaaatg
gctgccgattatgtctgtgcaatgcgacacagcgagatcgccaaagaggacattgaggtc
gttctgaatgcggatggtgtgcttctcgacatgctcaatcgcagcagcgaacagctcaag
tgcaatgtgctgcccagtcctctgtcgctgccagcgcaacgggcgagcgccacctacgag
gagacggtcaaggagctgattaacgatgagaaacaatatcagcgagatctgcatatgatc
attcgtgtctttcgcgaggagctactcaaaattgcacgcgatccaaaggagctggagccg
atattctccaatatcattgacatttatgaggtaacagtgacgctgcttggctcccttgag
gatgtcatcgagatgtctcaggaacagaatgcgccctgtgtggccagctgttttgaggag
ctcgccgaggccgaggagttcgatgtctataagaaatatgcacacgacgtcacctcgcag
gcatcgcgcgatgctctaagcaatctgcttgccaagcccgacgccctgtcgcttatgtct
gccggccatggtttccgtgaggcggtcaagtattatttgcccaagctgttgctggtgccc
atctgccatgcgtttgtctattttgactatatcaagcatttcatggatctcagtacatca
caggacgacatcgagagctttgctcaagtgcagggcttgctccatccgttgcactgcgat
ctcgagaaggtattggccaacttgtctaagaagcgactcgtcccagtcagcggtcgtgtg
cgacgccaaatggctattgagcggacacgggagctgcagctgaaggtcgagcactgggat
gacaaagatgtgggccttaattgcaatgagtttatacgcgaggattcactcagcaagctt
ggctcgggcaaacgcatctggagcgagcgcaaggtattccttttcgatggtctcatggtt
ttatgcaaggcaaatactaagaagcagaccccatcggctggtgccaccgcctacgattat
cgactgaaggagaagttctttatgcgtcgcgtcgagatcaacgatcgtgcggatacggat
gagctgaagcacagctttgaactaatcacacgcatacattccgtcattgtgctctccgca
gagaatgcccagcacaagagtgactggatggctgatttgattatggtgaatacgaaatca
atgctagatcgtatactggacagcatactacaagacattgagcgcaagcatccgttacgc
atgcccagcgcggagatctacaaatttgcggtgcccgacagcgctgagaatattgtatta
gaggagcgtgacagtggcgtagtgccgatgattaagggtgctactctatgcaaactgatc
gagcgcctcacctatcacatctatgcggatccgacgtttgtgcgcacctttctcaccaca
tatcggtacttctgctcgccgcagcagcttctgacgctgctaatcgaacgcttcgagata
ccggagccaagtctcgtttaccaggagcagcagtcgaaccacaatgaacatcatcacgac
aaagatgcatcagcgacagcgacggtgtcaacggcggatagcgagaaaatgttaaagaac
tcgcagcgcgaggattggaaacgttatcgcaaggagttcgtgcagccagtgcaatttcgt
gtgctgaatgtcctgcgccactgggtggatcatcatttctatgattttgagaaggatcca
acgctgctggacagactgttgcattttctcaatgacgtcaacagcaaatccatgcgcaaa
tgggtagactctgtgcgcaagattgtcgatcgcaagaacaagcaaagcaataagaagatc
gtctatgcctatggacacgatccgccacccattgaataccatttgaatgtgcccgatgag
gagataacgctactgacgttgcatccattagaggtggcaagacagctaactcttctggag
tttgagatgtacaagaatgtgaagccatcggagctggtcggctcgccgtggaccaaaaag
gataaggagttaaagagtcccaatctgctcaagattatgaagcatacgacaaatgtgacg
cgctggatcgaaaggtccatcatggaggcggagaacttcgatgagcggctggccattatg
cagcgcgccattgaggtgatgatggtgatgctggagctgaacaatttcaatggcatccta
tcgattgttgctgccatgggcacagcggctgtgtttcgactgcgtttcacgttcaatgcg
ctgccggagcggcatcgcaaattccttgacgagtgccgtgaactaagcgaagatcatctc
aagaaataccaggagcgcctacgctccattaatccgccctgtgtgccattttttggtcgc
tatttgacgaacatcctacatctggaagagggcaatccggatttgctgaccaacaccgag
ttgattaacttctccaagcgacggaaagtatcggaaatcattggcgagattcaacagtat
caaaatcaaccttattgcctcaacgaggagcccacaatacggcacttcttcgagcagctc
gatccatttaacggactctccgacaaagaaatgtccgactatctctacaatgaaagtatg
cgcattgaaccgcgcgccagcaaaacagtacccaaatttccacgcaaatggccgaacatt
ccgctcaagtcgccaggcattaaaccgcgtcgtcaaaaccaaagcaacaatagcagcaag
ctgtccagcaatgtgcccgttaacgtggagccaccaatgccagcggcggcagcaacaaca
acaacgacgacggcgacaacagcagcagtcacatccagcatcggcgagcagagtccgcag
cataatccgcatgcatattccgtatttgcgcctgtcatcattccagagcgcaatgggggt
agcagctggagcagcgttgcgccgcatcggacacctgacaatggtgaggtggcgccggcg
ccgcatctgccgcgtaagccggcggcgcacgtatggacacacaacagcgcgccagcggat
gtgtttagtccagcgctggcggagacacagccctcagcagcagctgccgcagttggagca
gcagccgctgcagctgccggcggctggaacaacatatccgattgctatgtcatctcggat
gcaagttcggatgtgttgccgccatcgccgctacccaaactgatgataagtccgcggcat
gaggcgacgccgttgccaccagcaccgcaaggtagcagcaatcgttcaccattccatgga
cgcactgcacacacgcaatacagtccgacacacagcattgccagcacagtgacgctcatt
ggaggcggcggcagcggcagtggcggtcttggagatgtgagtccacaattgggcggcttc
tattacaacagcgagcagagccatggccaggcggccggagtgcccatatcgccgcatgtc
aacgtgcccactgcaaccacactggagtaccgagcagtgccgccaccactgccaccgcgt
cgcaaggaacgcacggagagctgcgcggatatggcacaaaagcgtcaagcgcccgatgca
cccacactacctccgcgcgatggcgagctgagcccaccacccataccgccccgactcaat
cattccatggcagcgggctatgcacgtcagccaaaggagtttgttggcagaagcagcagt
ttgctgctacctcacacgagcagtattatgatacgccgcaattcggcaaagcagccatcg
ctgtccgttaatgcggctgctgtaacgggcagcggattgggtgtcaccaatgccgcaaca
gcggaatcaactggcatggccagtgatgagcagctgcagcaaccgcaactgctgcagcag
ccaccgcagtcgatctcgccggcgttgagctcctcgacgaccacatctcccatgacacca
atgacgcccatgtccccgtacattcccagcaccattgacgccaacacgtcgagcagctac
cagcagcaacagcagcgcctcaggccacaacagccgcaaacacagcagtcacagcaacaa
catcatcaccagcatcatcagcatcatacgcatacacatccacattctcaacatcagcat
tcatcacagcacccgaacagacgctcgtctccaaaggaattcttttcgattgccacgagc
cacgagggcacacccaaacttccaccaaaacctagtctaagcgcaaatttatacaacaat
ccagataaaggtacgatgtttctttacccaagtacaaaccaagattaa

DBGET integrated database retrieval system