KEGG   Drosophila grimshawi: Dgri_GH11213Help
Entry
Dgri_GH11213      CDS       T01061                                 

Definition
(RefSeq) GH11213 gene product from transcript GH11213-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00040  Pentose and glucuronate interconversions
dgr00053  Ascorbate and aldarate metabolism
dgr00830  Retinol metabolism
dgr00860  Porphyrin and chlorophyll metabolism
dgr00980  Metabolism of xenobiotics by cytochrome P450
dgr00982  Drug metabolism - cytochrome P450
dgr00983  Drug metabolism - other enzymes
dgr01100  Metabolic pathways
Module
dgr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH11213
   00053 Ascorbate and aldarate metabolism
    Dgri_GH11213
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dgri_GH11213
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH11213
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dgri_GH11213
   00982 Drug metabolism - cytochrome P450
    Dgri_GH11213
   00983 Drug metabolism - other enzymes
    Dgri_GH11213
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dgri_GH11213
Glycosyltransferases [BR:dgr01003]
 Others
  Hydrophobic molecule
   Dgri_GH11213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 6562342
NCBI-ProteinID: XP_001988523
FlyBase: FBgn0118694
UniProt: B4JDM0
AA seq 533 aa AA seqDB search
MQMQMQLQSRSLLWLFLLVINGLGGNAYRILFMGPFPAPSHWMWLEHFQRDLLKRGHEVT
SINNHPTKTPHENLTEIILNPTFDIPKHFPKKNIFSMRFASDFQNLQMWWLIGQMTTEHA
LQDVQVQRLIASQDEHYDLVILEQFFHEAFLMFGQKFKCPVVTIGTMGYADNMDHAMGIL
TPWSVIPHLLLPHTDQMTFTQRVYNTYLSVYDAAMRRWWYLPRMQQIAEKYFGAAIKGAL
PHVHDLERNISLMLINSHRSVDLPRPSMPGLINVGGAHIQPAKELPHDMQNFLDNATHGV
VYFSLGSYMKSTDMPPEKTAQILQAFGKLKQKVLWKYENASIGQLPANVMISKWMPQNDI
LAHANMKVFITHGGIFGTQEGIYWGVPMLCIPLYGDQHRNTIKSVREGYARSLVFSKLTV
DDLVRNIEALIYEPQYKRSALEVSQRFRDNPMHPLDEASFWIEYIIRHKGARHLKSQGAF
LPLYQYLLLDILGCVLLALFLTVWLPWRMLRRVHRWWSMAAAKAQAQEVKKQL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgcagatgcagctgcaatcgagatctttactctggctttttctgctggttata
aatgggttaggtggcaatgcttatcgcatactctttatgggcccctttcccgcacccagt
cactggatgtggctggagcactttcagcgggatctactgaagcgtggacacgaggtgacc
agcattaacaatcatccaacgaagacgccacacgaaaatctaactgagattattctcaat
ccgacttttgatatacccaagcattttcccaagaagaacatattcagcatgcgttttgcc
agtgattttcaaaatctgcaaatgtggtggctaattggtcaaatgactacggagcatgcg
ttgcaggatgtgcaagttcaaagactcatcgctagtcaggatgagcactatgatctcgtt
attttagagcagttctttcacgaggcattcctcatgtttggtcagaagttcaagtgtcct
gtggtcaccattggcaccatgggctacgctgataatatggatcatgccatgggcatccta
acaccctggtcggtcatacctcatctgctactgccacacaccgatcagatgacctttact
caacgtgtctacaacacatatctctccgtttatgatgcagctatgagacgatggtggtat
ctacccagaatgcaacagatagcggagaagtacttcggagcagctattaaaggtgcccta
ccccatgtgcatgacctggagcggaatatatcgctgatgctgatcaatagtcatcgcagt
gtggatctgccacgccccagtatgccgggcctgatcaatgtgggcggagcgcacattcag
cctgccaaggaattgccccacgatatgcaaaactttctggacaatgcaacgcatggcgtt
gtctacttcagtctgggctcctatatgaagagcactgatatgccgcccgagaagacagct
cagatactacaggcttttggcaaactcaaacagaaggttctgtggaaatatgagaatgca
tccataggacaattgcctgcgaatgttatgataagcaagtggatgccacagaatgacatt
ctggcacatgcgaatatgaaagttttcatcacacacggcggcatctttggcacccaggaa
ggcatatattggggcgtcccaatgctgtgcattcccttatatggagatcagcatagaaat
accattaaatcggtgcgtgaaggttatgcccgttctctagtcttttctaagctgactgtc
gatgatctggtgcgcaatattgaggctctaatttatgaaccacaatacaaacgtagtgct
ctggaggtgtctcaacgtttccgggataatcccatgcatccgctggatgaagccagcttc
tggattgagtacatcattaggcataagggagcgcggcatctgaaatcgcaaggtgccttt
ctgccactctatcagtatctgctgcttgatattttgggctgtgtactcctggctctcttt
ctgaccgtgtggctgccttggcgcatgctgagaagggtccacagatggtggtctatggcg
gcagcaaaagctcaggctcaggaggtcaagaaacaattgtaa

DBGET integrated database retrieval system