KEGG   Drosophila grimshawi: Dgri_GH11375Help
Entry
Dgri_GH11375      CDS       T01061                                 

Definition
GH11375 gene product from transcript GH11375-RA
Orthology
K08738  
cytochrome c
Organism
dgr  Drosophila grimshawi
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dgri_GH11375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 103 aa AA seqDB search
MGADAENGKKIFVQKCAQCHTYEGGKHKQGPSLAGVVGRKCGTTAGYKYTDANMKRAVVW
TEGNLDEYLKDPKKYIPGTKMVFPGLKKAEDRADLIAFLKQNK
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgatgcggagaatggcaaaaagattttcgttcagaaatgcgctcagtgccac
acatatgaaggtggtaagcacaagcagggtcccagtttggctggagttgttggccgcaag
tgtggcacaaccgctggctacaaatataccgatgctaatatgaaaagggccgtcgtctgg
actgaaggcaacctcgatgagtatctaaaggatccaaagaaatatatacctggtactaag
atggtttttcccgggctcaagaaagctgaagatcgcgctgatttgattgcattcctcaaa
caaaataaataa

DBGET integrated database retrieval system