KEGG   Drosophila grimshawi: Dgri_GH11376Help
Entry
Dgri_GH11376      CDS       T01061                                 

Definition
GH11376 gene product from transcript GH11376-RA
Orthology
K08738  
cytochrome c
Organism
dgr  Drosophila grimshawi
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dgri_GH11376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAK
GITWTEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgccagctggtgatgttgagaagggcaagaagctgttcgtgcagcgttgcgca
cagtgccacaccgttgaggccggtggcaagcacaaggttggccccaatctgcacggtctg
atcggtcgcaagactggccaggcggccggctttgcctacacagatgccaacaaggccaag
ggcatcacctggactgaggacacactgttcgagtacctggagaaccccaagaaatatatc
cccggcaccaagatgatcttcgccggcctcaaaaagcccaacgagcgtggtgatctgatt
gcctacctcaagtcggctaccaagtaa

DBGET integrated database retrieval system