KEGG   Drosophila grimshawi: Dgri_GH11387Help
Entry
Dgri_GH11387      CDS       T01061                                 

Definition
GH11387 gene product from transcript GH11387-RA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dgr  Drosophila grimshawi
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dgri_GH11387
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dgri_GH11387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2457 aa AA seqDB search
MSTPSNVQHFVNGLKSRNRNVQNKAAQDLFLYVKTELREMSQEELMKFFDDFDHHIFNMV
NSPDINEKKGGALAMKCLISGDALITRKGISPYLNRLRDLLLINDVSIMEIAARSLVKLA
NMPGSKGAESFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFEHI
FNAIFDPKPAIRKSAGEALRAALIVTAQRESTKQSSEPQWYNICYEEASNSFKTEVLTGK
EQKGMTRDDRIHGGLIVFNELFRCANAQWERQYTTLKKLFPKSQHNKFLEAGSSSSVGSQ
LTTIVPRLKVPFVDKLGSTQMHMDSEQHNGIGNKLASHNVLESAYAHEILKKHFIKICDN
VLEQRSSKSLYVQQALLQIMPRLAAFNREVFVEQYLNRCVAHLMAILRGKEKDRNVAYIT
IGYIAVAVESDIENLLKPIMSNIKQALPLKELASKRKVPVDATVFACITLLAHAVKSQIA
EDVREILEQMFHTGLSPALTVCLRELAENVSELKSAITEGLIGVLFQVLMNKPAAIPYAT
MPPISIDASLMLQSADSPTIVLALRTLGTFNFQEQNMLDFVQRCADFFIVHEQQEIRLEA
VQTCTRLLKLAVKDSAESMENSKTLSDTVSHVIERLLTVAITDMDYNVRIRILRSLDETF
DAKLAQPESLNALFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDLKY
SGMSRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVVLNVLRTIGDL
AEVNGGSNEMELWADELLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPV
LIDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKSD
ESQDISSAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFHTLGIK
CVPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMDDIFKLIKEFWTIN
TPLHSTLINLIEQIALALGCEFRDYLAQLIPQILRGLQQDSSKDRMDTRRLLQALQKFGS
TLGYYLPLILPPIIKFFDSPYVPQQVSLVALETISVLAGQLDFSDYSSRIIHPLVRVLET
EPELREQAMTTLRSLVKQLGKKYLVFVPMVQRTMSRHRIVDPEYEKLLTRIQSNSTLADP
CGISFGIGIHFGQRQAKYNEPFVLDSNSSSKNLKVSTTALRTAWQVSRRVSKDDWVEWLK
RLSVGLLKESPSHALRACCVLAQDYDTLLRDLFNAAFISCWTKLSKEHKDELTQSLIQAL
KITDMPEITQTILNLAEFMEHCDRDPIPFETQLLGTRAMACRAYAKALRYKEKEFVERQE
APVFESLILINNKLQQREAAEGLLTTYRNSANKGNVHGRWYEKLHNWDQALHHYQLNLNA
DTNDLEARLGHMRCLEALGDWSQLSSKCKEEWPKFSTEDKARASPLAAVAAWGLQDWEGM
QEYVRCIPVDTQDGSYYRAVLAVHREEYETAQRLIDETRDLLDTELTSMAGESYERAYGA
MVCVQMLAELEEVIQYKLIPDRREPLKAMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHED
IHTWLKYASLCRKSGSLYLSHKTLVMLLGTDPQLAPDEPLPCNLPQVTYAYTKYLAGSGE
PELAYKQLDDFVNTYSAQLTCLPPEARKPQDQRLMARCYLRLATWQNKQHENRSNQDAVK
GALECFAQATSYDPNWYKAWHLWAYMNFKVVREKSPSGLDSDRSIIQKYAVPAVQGFFRS
ISLIQGNSLQDTLRLLTLWFDYGHHAEVFHALDSGMKVIEINTWLQVIPQLIARIDTHRR
LVGQLIHTLLIDVGKNHPQALVYPLTVASKSASLSRKNAAFKVLDSMRKHSPTLVEQAVM
CSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAMLDRGPQTLKETSFS
QAYGRELTEAYEWTQRYKTSAVLMDLDRAWDIYYHVFQKISRQLPQLTSLELPYVSPKLM
TCKNLELAVPGSYNPGQELIRISHIKTNLQVITSKQRPRKLCIRGSNGKDYMYLLKGHED
LRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGWVPHCDTLHTLIR
DYRDKKKVPLNQEHRTMLNYAPDYDHLTLMQKVEVFEYALGQTQGDDLAMLLWLKSPSSE
LWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFGDCFEVAMTREKF
PEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLEAFVYDPLLNWRL
LDVDKKANETTTTSSAAAVGSGGSPSNSNEQESLLQGNPMAKSKTYEPQLPHGALSNVAD
VTSGKASMVIQRVNRKLTGTDFQMSKMTEQQQVELLIQQATNNENLCQCYIGWCPFW
NT seq 7374 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaccatcgaatgtgcagcacttcgttaacgggctcaagtcccgcaatcgcaat
gtgcaaaacaaggcggcgcaggatctctttctgtatgtcaaaacggaactgcgtgaaatg
tctcaggaggagctaatgaaattctttgacgatttcgatcatcacatctttaacatggtc
aactcaccggacatcaacgagaaaaagggtggcgccctcgcaatgaagtgcctcattagc
ggcgatgccttgataacgcgcaaaggtatctctccctacctcaatcgcttgcgtgatcta
ctgctcattaacgatgtgtccatcatggaaatagcggctcgctccttggtcaaactggct
aatatgcccggctctaagggagctgaatcctttgactttgacatcaaaaaggccttcgag
atgctcagcggcgaccgacaagagtatcgccgtcatgcggccgtcttcattttacgagaa
ttggccattgcgctgcccacgtatttctatcagcagattcttacgtttttcgagcacata
ttcaacgcgatcttcgatccaaagccagcgatacgcaaatcagctggcgaggcactacga
gccgccctcatcgtcacggcacagcgcgagagcaccaagcaatcgagcgagccgcaatgg
tataacatctgctacgaggaggcgagcaacagcttcaagaccgaagtgctcacgggcaag
gagcagaagggaatgacgcgcgacgatcgcatacacggcggcctcatcgtcttcaacgag
ctcttccgttgcgccaatgcgcaatgggagcgacaatatacaacgctgaagaagctcttc
ccaaagtcgcagcacaacaagtttctggaggcgggcagctcctcatctgtgggcagtcag
ctaaccacgattgtgccgcgcctgaaggtgccctttgtggataagctgggtagcacacag
atgcacatggatagcgagcagcacaatggcattggcaataagctggcaagccacaatgtg
ctggaatccgcttacgcgcacgagatacttaagaagcacttcatcaaaatttgcgacaat
gtgctggagcagcgttcgtcaaagtcactgtatgtgcagcaggcgctgctgcagataatg
ccacgtttggccgcttttaatcgtgaggtgttcgtggagcaatatctaaataggtgtgtg
gcacatttaatggcgatattgcgtggcaaggaaaaggatcgcaatgtggcctacatcaca
attggctacatagccgtcgctgtcgagagcgacattgagaatctgctcaagcccatcatg
agcaacattaagcaggcgctgccactcaaggaattagccagcaaacgtaaagtgcccgtc
gatgcgacagtctttgcgtgcatcacgctcctggcgcatgctgtcaaatcccaaatcgcg
gaggatgtacgagaaatacttgagcagatgttccacacgggtctgtcgccggcgttgacc
gtttgcctgcgcgaactggcggagaatgtgtcggaactgaagtcggccattaccgaaggt
ctgattggtgtgctcttccaggtgctgatgaataagccggcggccattccgtatgccacc
atgccacccattagcattgatgcctccctgatgctgcagagtgccgatagtccaaccatt
gtcctcgctctccgcacgctgggcaccttcaatttccaggagcagaatatgctggacttt
gtgcaacgctgtgcggactttttcattgtgcacgagcagcaggagattcgcctggaagcg
gtgcaaacgtgcacgcgtctgctcaagctggccgtaaaagattcggcggagagcatggag
aactccaagacgttgagcgatacggtgtcgcatgtgattgaacgcctgctgacggtggcc
atcacggatatggattacaatgtgcgcatccgcattctccgctcgctggatgagacattc
gatgcgaaactggcgcagccggaatcgcttaatgcgctcttcattacgctgcacgatgag
atctttgagatacgtgaactggccatggtcaccattggacgactgtcgtccatgaatccc
gcctatgtgatgcccaaattgcgcaccacaatgatcgagctgctcacggatctgaagtac
tcgggtatgagtcgcaacaaggagcagagcgcacgaatgctggatcatctagtcattagc
acaccgcgtctcatttcatcctacatgaatcctatactgaaggcactagtgcccaagctg
cacgaaccggaatcgaatccgggcgtggtgctcaatgtgctgcgtacaattggtgatttg
gccgaggtcaatggtggctccaatgaaatggaattgtgggcagacgagttgctctctata
ctgctcgagatgctcggggatgcgggcagtccagacaaacggggcgtggccctctggaca
ctgggtcagctgattagcgccacaggtcgtgtggttagcccctatcacaaatatccggtt
ctcatcgatatactcatcaattttctgaagaccgaacagcgtcgctccatacgacgtgag
acgattcgtgtgttgggtctgcttggcgctatggatccgtacaagcacaagatgaacaag
ggtctgatcgatagccaaaaggataatgtgctaattgcctactccgatggcaaatcggat
gagagccaggacatctcgtcggccgaactgctcgtcaatatgggcaatgccctagatgaa
tactatccggccgtggcaattgccgcactcatgcgcatcctacgcgatcccacgctgagc
acccgtcacaccagtgttgtgcaggccgtcacctttatctttcacacgctgggcatcaaa
tgtgtgccttatttggcccaggtgctgcccaatctgttggacaatgtgcgcacggctgac
aataatctgcgcgagttcctcttccagcagctggccatccttgtggcctttgtcaagctg
cacatcatcagctacatggatgacatcttcaagctgatcaaggaattctggacaatcaat
acgccgctgcactccacgctgatcaatctgattgaacagattgccctcgcgttgggctgc
gagtttcgggattatctggcgcagttaataccacaaattttgcgtggtctgcaacaggat
agctccaaggatcgcatggacacacgtcgactgctccaggcactgcagaaatttggcagc
actctgggctactatttaccattgattctgccgcccataattaagttctttgattcaccc
tatgtgccgcagcaggtctcgctggttgccctggagaccattagtgtgctggccggtcaa
ttggatttctccgattactcgtcacgcatcattcatccgttggtgcgtgtgctcgaaacc
gaaccagagctgcgggaacaggcaatgaccacgttgcgttccctagtcaaacagctgggc
aaaaagtatctggtatttgtgcccatggtgcaacgcaccatgagtcgtcatcggatcgtg
gaccccgaatatgagaagctacttacccgcatccaatccaatagcaccctggccgatccg
tgcggcattagttttggcattggcattcattttggccagcgccaagccaaatacaatgaa
ccctttgtcctggacagcaatagcagcagtaagaatctaaaggtttcaacgacagcgttg
cgcactgcgtggcaagtgtcgcgtcgcgtctccaaggatgactgggtcgagtggctgaag
cgtctgtccgtcggtttgctcaaggagtcgccgtcacatgcgttgcgcgcctgctgtgtc
ctcgcccaggattacgataccctgctgcgggatctctttaatgccgccttcatctcctgc
tggacgaaactgtcgaaagagcataaagacgaactaacccaatcgctgatccaggcactg
aagatcacagacatgccagagatcacacagaccattctcaatctggccgaatttatggag
cactgtgatcgtgatcccattccgtttgagacccaactgctgggcacccgggcgatggcg
tgtcgtgcctatgcgaaagccctgcgctacaaggagaaggagtttgtggagcgccaggag
gcgcccgtcttcgaatcgctaatcctcatcaataacaagctgcagcagcgcgaggcagcc
gagggattgctcaccacctatcgcaattcggcgaacaagggcaatgtccacggacgctgg
tacgagaagctacacaattgggatcaggctctgcatcactatcagctcaatttgaatgcg
gacacaaatgatctggaggcgcgtctgggtcacatgcgttgcctggaggcgctcggcgat
tggtcgcagctgagtagcaagtgcaaagaggaatggcccaaattcagtaccgaggacaag
gccagggcgagtccattggccgccgttgccgcctggggcctacaggattgggagggtatg
caggagtatgtgcgctgcattcccgtcgacacccaggatggcagctattatcgcgccgtg
ctggccgttcaccgcgaggagtacgagacggcacagcgtttgatcgatgagacgcgagat
ttgctggacaccgaactgacctccatggcgggtgaatcctatgaacgtgcctatggcgcc
atggtctgtgtccaaatgcttgccgaactggaggaggttatccaatacaaactcataccg
gatcgtcgcgaaccgctgaaagcgatgtggtggaaacgtttgcagggcggtcagcgtctg
gttgaggattggcgtcgcatcatccaggtgcattcgctggtcgtcaagccgcacgaggat
atacacacctggctaaagtatgccagtctctgtcgcaagagcggctctctgtatttgtcg
cacaagacgttggtcatgctgctgggcaccgatccgcagctggcgccggatgaaccgttg
ccctgcaatctgccccaggtcacgtatgcatataccaaatatctggctgggtccggcgag
cccgagctggcctacaagcagctggatgactttgttaatacgtatagtgcccaactgact
tgcctgccgccagaggcacgcaagccgcaggatcagcgtctgatggctcgctgctatctg
cgcctggccacgtggcagaacaaacagcacgagaatcgttccaatcaggacgcggtgaag
ggtgctctcgagtgctttgcccaggcgacatcctatgatcccaactggtacaaggcctgg
catctgtgggcctacatgaacttcaaggtggtgcgcgagaaatcgccctctggtctggac
agcgatcgttccatcatccagaaatatgcggtgccggcggtgcagggtttcttccgttcg
attagcctgatccaaggcaattcgctgcaggatacgctgcgtctgttgaccctgtggttt
gactatggccatcatgctgaggtttttcatgcgctcgactctggcatgaaggtgatcgag
atcaatacctggctgcaggtgataccacagttaattgcacgcatcgatacacatcggcga
ctggtcggccaactcatccatacgctgctcatcgacgttggcaagaatcatccgcaggcg
ctcgtttatcccctgaccgttgcctccaagtcggcatcgctatcgcgtaaaaatgccgcc
ttcaaagtgctcgattcgatgcgcaaacattcaccgactctcgtcgagcaggcggtcatg
tgcagcgaggagctgattcgtgtggccatactgtggcacgagcagtggcacgaaggattg
gaggaggcatcacgtctctactttggggatcgcaatgtgaagggcatgttcgagattctg
gaaccgttgcacgcaatgctggaccgcggaccgcaaaccctcaaggagacatccttctcg
caggcgtacggccgtgaactgaccgaggcgtacgagtggacgcaacgctacaagacttca
gcggtgctcatggatctggatcgtgcctgggatatctattatcatgtgtttcagaagatt
tcgcgacagctgccgcagctgacatcgctggagttgccttatgtgtcgcccaagctgatg
acgtgcaagaatctggaattggctgtgccgggctcatataatcccggccaggagctgata
cgcattagccatatcaagaccaatctgcaggtgatcacgtccaagcagcggccgcgcaaa
ctttgcatacgtggctccaacggcaaggactatatgtatctgttgaaggggcacgaggat
ctgcggcaggatgagcgtgtaatgcagctattctcgctggtcaacacactgctgctcgac
gatccggatacgttccggcgcaatctggccattcaacgctatgcggtcattccgctgagc
accaattccggactgattggctgggtgccgcactgtgatacgctgcacacgttgatccgt
gattatcgcgacaagaagaaggtgccgcttaatcaggagcatcgcaccatgctcaactat
gcgcccgactacgatcatctgacgctcatgcaaaaggttgaggtcttcgaatatgctttg
ggacagacgcaaggcgatgatctggccatgctgctctggctaaagtcaccgtcatcggaa
ttgtggttcgagcgacgcaacaattacacacgctccttggcggtcatgtccatggtgggc
tatatactcggcctgggggatcgacatccatccaatttgatgttggatcgcatgagtggt
aaaattctacacatcgatttcggtgattgtttcgaggtggcaatgacacgtgaaaagttt
ccggagaaaataccgttccggctgacacggatgctgatcaaggcgatggaggtgacgggc
attgagggcacctatcgacgcacttgcgagagtgtgatgctcgtgctgcgacgcaacaag
gactcactgatggccgtgcttgaggcattcgtctacgatccgttgctcaactggcgactc
ctcgatgtggacaagaaggcgaatgagacgacgacgacgtcgtcggcggcagctgtcgga
agtggcggcagtccgagcaactccaatgaacaggagtctctgctgcagggcaatccgatg
gccaagtccaagacgtatgagccacagttgccgcacggcgccctatccaatgtggcggat
gtgaccagcggcaaggccagcatggtcatacagcgggtcaatcgcaaattgaccggcacc
gatttccaaatgagcaagatgacggagcagcagcaggtggagctgctcatacagcaggcg
acgaacaatgagaacctctgccagtgctatattggctggtgccccttctggtaa

DBGET integrated database retrieval system