KEGG   Drosophila grimshawi: Dgri_GH11470Help
Entry
Dgri_GH11470      CDS       T01061                                 

Definition
GH11470 gene product from transcript GH11470-RA
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 229 aa AA seqDB search
MSIWTPLESNPEVLTKYIHKLGVSPSWSVIDVIGLDDELLAMLPMPVKALVLLFPISQKY
EEFCAEEKKRIMAGAEPEKHPEDLFYMRQFTHNACGTVALIHSVANNKDIDIADGVLKSF
LDNGLALSPEERGHALEKDKAFTEDHQKLALEGQTDAAAYEKVIHHFIALVNKEDTLYEL
DGRKSYPVSHGKTSAETFVRDAAKVCKEFMARDPDELRFTVLALAATEA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatctggacaccattggaatctaacccggaggtgctgaccaaatacatacacaag
ctgggcgtgtcgccgtcctggtcggtaattgacgtcatcggtctggatgatgagttgctc
gcaatgttgccaatgcccgtcaaggctctcgtcctcctctttcccatcagccaaaagtat
gaagagttttgcgctgaggaaaagaaacgcataatggctggcgctgaaccggaaaagcat
ccggaagatctcttctatatgcgtcaattcacccataatgcctgtggcaccgttgctctc
atccacagtgtggccaacaataaagacattgatatcgctgatggtgtgctgaagtctttc
ctggataatggacttgccttatcgccggaggaacgcggtcatgccttggagaaagacaag
gccttcaccgaggaccatcagaagctggccctggagggacaaactgatgcagccgcctat
gagaaagtgattcatcatttcattgcacttgttaacaaggaggataccctatacgagctg
gatggccgcaaatcgtatccagtcagtcatggcaagacatcggcggagacctttgtgcgt
gatgccgccaaggtgtgtaaggagttcatggcccgggatccagatgaattgcgttttaca
gtcttggctctggctgccaccgaagcataa

DBGET integrated database retrieval system