KEGG   Drosophila grimshawi: Dgri_GH11568Help
Entry
Dgri_GH11568      CDS       T01061                                 

Definition
(RefSeq) GH11568 gene product from transcript GH11568-RA
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00040  Pentose and glucuronate interconversions
dgr00053  Ascorbate and aldarate metabolism
dgr00830  Retinol metabolism
dgr00860  Porphyrin and chlorophyll metabolism
dgr00980  Metabolism of xenobiotics by cytochrome P450
dgr00982  Drug metabolism - cytochrome P450
dgr00983  Drug metabolism - other enzymes
dgr01100  Metabolic pathways
Module
dgr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dgri_GH11568
   00053 Ascorbate and aldarate metabolism
    Dgri_GH11568
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dgri_GH11568
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH11568
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dgri_GH11568
   00982 Drug metabolism - cytochrome P450
    Dgri_GH11568
   00983 Drug metabolism - other enzymes
    Dgri_GH11568
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dgri_GH11568
Glycosyltransferases [BR:dgr01003]
 Others
  Hydrophobic molecule
   Dgri_GH11568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_1_3 DUF4713 Glyco_trans_4_2 Glyco_transf_4 Arena_nucleocap
Motif
Other DBs
NCBI-GeneID: 6561790
NCBI-ProteinID: XP_001989155
FlyBase: FBgn0119048
UniProt: B4JBJ9
AA seq 545 aa AA seqDB search
MSQQTGSLISCTFVCLLLAFFAGQSLPVEGANILGVFTSHSPSHLIIHMSAMKALAEAGH
NVTVVCTSVPKVTHKSIKQIVIPLTEEEEKQLNAGMTGMAKEKPSIINTFKNLLGSLSMY
IDKQVDVLEDKRFTDLYKNKDNKFDAVVFGFFFNYYQVGLGSLFNCPLILSWTSAPMSIV
DESVGNPELIALVPSMNVAVKPGQAMNFKQRLANYFGTTLFRFIGFYLETKNVVFYDRLW
GKIPDMISYDEAKKNVSLALCNSHAISEGPVRPNVPAVIEIGGIQIKEKPDPLPQDMQEF
LDNAKNGAILLSLGSNLKSENVKPESVEKIFETLSKLKQRVIWKWDDLKHTPGKSANILY
KSWLPQDDILAHPNIKLFITHAGKGGVAESLYHAKPMLALPVFADQPNNADKLVQSGYGI
RVDLLTLEADEFKASIKELLQNPIYTKNVQAFSKLYRDRPMSARESVVYWVNYVLRHHGA
AHMQSPLVHMNFIAASNLDVYAFLAFVLFIASLISFVVLRFCYRKCCGGKGKPQKSSQKS
KVKKH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcagacaggatctttaatatcctgcacatttgtgtgccttttgctggcattc
tttgctggccaatctttgcccgtggagggtgcaaatattttgggcgtattcaccagtcac
agcccatcacatctgattattcacatgtccgcgatgaaagcgttggcggaggcaggtcac
aatgtcaccgttgtgtgcacatcagtgccaaaggtcacgcacaagagcatcaaacagatt
gtgataccattgactgaagaggaggagaagcaactcaatgctggcatgacgggcatggcc
aaagagaagccatccataattaacacattcaagaatttgttgggttcactgtcgatgtac
atcgacaagcaggtggatgtgttggaggacaaacgcttcacggatctctacaagaacaag
gataacaaatttgatgcagtcgtcttcggattctttttcaattactaccaagttggattg
ggctccctatttaactgtcctctgattctgagctggacgagtgcacccatgtctatagtc
gatgagtctgttggcaatcccgaacttatagccctcgtgcccagcatgaatgtcgcagtg
aaacctggtcaagccatgaacttcaaacagcgattggccaactattttggcacaacgctt
ttccgctttattggcttctatctggagacgaaaaatgtggtattttacgatcgtctgtgg
ggtaagattccagacatgatcagttatgatgaggcgaaaaagaacgtgtcgctggccctc
tgcaatagtcatgcgataagcgagggacccgtcaggcccaatgtgcccgcagtgattgag
attggcggcatacagattaaggagaagcccgatccattgccacaggatatgcaggagttt
ttggacaatgccaagaatggtgccattctcctcagtttgggcagcaatctaaagagtgaa
aatgtgaagccagagtctgttgagaagattttcgaaacgctgtccaaactcaaacaacgg
gtgatctggaaatgggatgatctgaagcatacgcccggaaaatcggcgaatatactctac
aagagctggctgccccaggatgatatactcgctcatcccaatatcaaactgttcattacc
catgcaggcaaaggaggtgtggccgaatctctgtaccatgccaagcccatgttggcgctt
cccgtcttcgccgatcaacccaacaatgctgataagttggttcaatcgggctacgggatt
cgtgtcgatttgttgaccctggaggcggacgagtttaaggcgagcatcaaggagctgctg
cagaatcccatctacaccaaaaatgtgcaggcattctcgaagctctatcgcgatcgtccg
atgtcagctcgcgaatcggttgtctactgggttaactatgtgttgcgtcatcatggcgct
gcccatatgcagagtccccttgtccacatgaactttattgccgccagcaatctggatgtg
tatgccttcctggcttttgtactctttattgcttcgctgatcagctttgttgtgctgaga
ttctgctatcgaaaatgttgtggtggcaaaggcaagccacaaaaatcatcccaaaagtca
aaggtcaagaagcactag

DBGET integrated database retrieval system