KEGG   Drosophila grimshawi: Dgri_GH11587Help
Entry
Dgri_GH11587      CDS       T01061                                 

Definition
(RefSeq) GH11587 gene product from transcript GH11587-RA
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Dgri_GH11587
    1.3.1.94  polyprenol reductase
     Dgri_GH11587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 323 aa AA seqDB search
MLLQVIGTLEDLIDQYKINVIQLIFITFIITIVLLGSLMTLLESHLPNCLRQSFRYGKHA
HKGATDAIVSHLEVPKAWFSHFYIFALAWSMLALYLISSAVWHQNGASEYVLRFLDLMCG
GRSQRQVLVDSNTALLGSALLGVQCLRRFYETNFVQIFSRRSKINLSHYAVGYMHYFGAI
ISLLGNTAGFVRGTEPTQFTLQNVTPIQGLYTVIFLFACWQQYASNLLLVRLRQHPKTGD
VQTEAHLMPSGGWFDYISSPHMFFEVVMYFCLADLFTPIITWKLIFLWVASNQTINALLT
HQWYKDSFKDYPKRRHAIIPWLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttgctacaagtgattggcaccctcgaggatctcatcgatcagtacaaaatcaatgtg
attcaattgatattcatcacattcatcataacgatcgtcttgctgggcagtctaatgacg
ctgctcgaatctcatctgcccaactgccttcgtcaatcatttcgctatggcaaacatgcc
cacaagggcgcaacggatgcaattgtcagccatttggaggtgcccaaggcatggttcagt
catttctacatctttgccttggcctggtcaatgctggcgctctatttgatcagtagcgcc
gtctggcatcaaaatggggcatcggaatacgtgctccgtttcctggatttgatgtgcggc
ggacggagtcaacgccaggtgctggtggactcgaatacagcgttgctgggctcagcgctg
ctcggcgttcaatgtctgcgtcgcttctacgaaacgaactttgtgcagatcttctccagg
cgcagcaaaataaatctgtcccattatgccgttggttatatgcattattttggtgccatt
atctcgctgctaggcaatacggcgggatttgtgcgtggcactgaaccgacacagtttaca
ttgcaaaatgttacgcccatccagggattgtatacagttatctttctgtttgcctgctgg
cagcaatatgccagcaatttgttgttggtcagactgcgccagcatccgaagacgggcgac
gttcaaacggaagcacatttaatgcccagtggcggctggtttgattacatctcgtcaccg
cacatgttcttcgaggtggtcatgtatttttgccttgcggatctcttcacgcccatcatc
acatggaaactgatctttttatgggtcgccagcaatcagacgattaatgccttgctcacg
catcaatggtacaaggacagcttcaaggattaccccaaacgtagacatgccatcattcct
tggctgctctag

DBGET integrated database retrieval system