KEGG   Drosophila grimshawi: Dgri_GH11609Help
Entry
Dgri_GH11609      CDS       T01061                                 

Definition
GH11609 gene product from transcript GH11609-RA
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     Dgri_GH11609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 770 aa AA seqDB search
MGQKFSCLKVCTNSDESPKSETDATTVRKRNVNANLLTTPDSGSSAVLGVQRVDLCLEDN
HEEHHTSHFYAAAAKEALIVRRGEPFRLRIYFTRDYSPSKDAISFIFSVTDDPKPNPGHG
TLMALVPHDGIDCLGDALEWGAGIEAHEGQILTVLVKPPTTCSVTEWRLDIDTKLLGDGS
RSYQLPLPIYVLFNPWCPEDQVYMESREERKEYVMHDTTLIWRGSYNRLRPSVWKIGQFE
RHVLECSIKLLGTVGRIPPAYRGDPVRVARALSALVNSVDDDGVLLGNWTEDFSGGTAPT
KWTGSAEILQQFHKTQKSVKFAQCWNFSGVLATIARALGIPSRVITCYSSAHDTQASLTV
DVFIDANNKKLEAETTDSIWNYHVWNEVWMQRPDLGVGQFGAYDGWQVVDATPQESSDNM
YRVGPASVLAVKHGEILRPFDCGFVYSEVNADKLYWRYNGPAQPLKLLRKDTLAIGHLIS
TKAVLKWEREDITASYKFEERTEEERSTMLKALKQSRHAFSRYYLNDNFNEVEFSMELKD
DIKVGENFTVVLKVSNKSDERIHQATGQLNCDAVLYTGVGAEEVKIMGFELDLKPKSTEY
VRMEVTFNEYFEKLSSQGAFQISAACRVKDTDYDYYAQDDFRVRKPDIKFQLGDAPIVAQ
QEIDVILRLANPLPIPLHRGVFTVEGPGIEQPLKFKIFEIPVGGTAAATFKYVPPYAGRG
TMLAKFSAKELDDVDGYRHYEIEPRPADILQPNGSHSSSNIIRRRTDVIP
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaaattctcttgcctgaaagtgtgtacaaattccgacgaatcacccaaaagt
gagacagacgcgacaacggtgcgcaagcgtaatgtcaatgcaaatctattgacgactccg
gattctggcagctcggcggtgctgggcgtgcagcgagtggatctttgcctggaggacaat
cacgaggagcaccacacaagtcatttctatgctgcggcagccaaggaggcgctgattgta
cgacgtggcgaaccattccggctgcgcatctatttcacccgagactatagtcccagcaag
gatgcgattagtttcatattcagtgtgacagatgatcccaaaccgaatccgggacatggc
acactgatggctctcgtgccgcacgatggcatcgattgtttgggcgatgccctcgaatgg
ggtgccggcattgaggcccatgagggtcagattctcacagtgctagtgaagccaccaacc
acatgctcggtcaccgaatggcggctggatatcgatacgaagctgttgggtgatggttcg
cgtagctatcaactgcccctgcccatttacgtgctctttaatccctggtgtcccgaggat
caggtctacatggagagtcgagaggagcgcaaggagtatgtgatgcacgacacgactttg
atatggcgcggctcctacaatcgattgcgtccctcagtctggaagattggccagttcgag
cgacatgtgctcgagtgcagcatcaaactgctgggcacagtgggtcgcataccacctgcc
tatcgaggtgatccggtgcgggtggcccgggcactgtccgccctggtcaattcggtggac
gacgatggtgtgctgttgggcaattggacggaggatttctcgggcggtacagcgccgacc
aaatggacgggctcagcggagattttgcaacagttccacaagacccaaaagtcggtgaaa
tttgcccagtgttggaatttcagtggagtgctagcaacgatagcccgtgctctgggcata
ccgtcacgtgtcatcacttgctactcctccgcccacgatacacaggcatccctaacggtg
gatgtgttcatcgatgcgaacaacaagaaattggaggcagagacaaccgattccatttgg
aattatcatgtgtggaacgaggtatggatgcagcgaccggatttgggtgtgggccaattc
ggtgcctatgatggatggcaggtggtggatgcgacgccgcaggaatcgtccgataatatg
tatcgagtgggtcccgcatccgtgctggccgttaagcatggcgaaatcctgcgtcccttc
gactgtggcttcgtctactcggaggtgaatgcggataagttatattggcgctacaatggt
cccgcacagccgctgaagctgttgcgcaaggatacgctggcaattggtcatctgattagc
accaaggcggtgctgaagtgggagcgagaggatattaccgctagctacaagtttgaggaa
cgcaccgaggaggaaaggagcacaatgctgaaggcattgaagcaatcccgtcatgcgttc
agtcgctactacctcaatgacaatttcaatgaggtcgagttcagcatggagctaaaggat
gacatcaaggtgggtgagaactttaccgttgtgcttaaggtgagcaacaagagcgacgag
cgcatccatcaggccacaggacagctcaactgtgatgccgtcctctatacgggcgtcggt
gcggaggaggtgaagatcatgggcttcgagctggatctgaagcccaagagtaccgaatat
gtacgcatggaggtcacattcaacgaatactttgagaagctatcatcgcagggcgcattc
caaatctcggccgcgtgtcgtgtcaaggataccgactacgattattatgctcaggatgat
ttccgtgttcgcaaaccggacatcaagttccagctgggcgatgcaccgattgtcgcccag
caggagatcgatgtgatcctgcgactggccaatccactgcccataccactgcatcgtggc
gtcttcaccgtcgagggccccggcattgagcagccgctcaagtttaagatatttgaaatt
cctgtgggcggcacggcagcggcgacctttaagtatgtgccaccgtatgcgggtcgtggc
acaatgttggccaagttcagtgccaaggagctggacgatgtggatggctatcggcactac
gagattgagccccgtcccgccgatatactccaaccgaacggaagtcacagcagcagcaat
atcatacgacgacgcaccgatgtcattccctga

DBGET integrated database retrieval system