KEGG   Drosophila grimshawi: Dgri_GH11651Help
Entry
Dgri_GH11651      CDS       T01061                                 

Definition
GH11651 gene product from transcript GH11651-RA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dgr  Drosophila grimshawi
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dgr00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dgr04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 421 aa AA seqDB search
MKLGHCAALFGLLLFATLFSAGNCLWPFSRKSNTPPTPPKEPQLSPVIFVPGDGGSQVEV
RLSKSYSPYFICEKTHDWYNLWLDLEQLVIPMVYCWVDNVKLYYDKATRTTHNSPGVETR
IPGWGDPDVVEWIDPTLNKAGAYFKDIGNLLVNMGYVRRRNIHGAPYDFRRAPNELQQFF
IDLKQLVEDTYEANNQTAVTFITHSMGSPMTLVFLQQQTLEWKTRYVRRQISLAGAWAGS
IKAVKVYAMGDDLDSFALSAKILRDEQISHPSTAWLLPSPLFWKPSEVLAMTPSKNYTMA
QLEQFFTDIDYKTGWEMRKDTMRYTQNFSPPDVELHCIYGDGISTVERLQYKKDNIAGET
PKLIMGVGDGTVNQRSLRACQHWSGQSSSQISTLALQGVDHMGVLTNQDVYQYIRTVMQQ
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcggacattgtgcagcactattcggattgctgctcttcgcaactttgttcagt
gctgggaactgtctttggccctttagccgcaaatcaaatactccgcctacgcctccaaag
gaacctcagttatcgcctgttatatttgtgccaggcgatggcggatctcaagtcgaggtg
cgtctaagcaaatcgtattcaccatattttatttgcgagaagacgcacgactggtataat
ctatggcttgatctggaacaattggtcataccgatggtctactgttgggtggacaatgtc
aagctctactatgacaaggcaacgcggacaacacacaattcacctggtgtcgagacacgc
atacccggttggggtgatcccgatgttgtcgaatggatagatccaaccctaaacaaagcg
ggtgcatatttcaaggatattggcaacttactcgttaacatgggttatgtgcgacgtaga
aatatacacggagcaccctatgattttcgcagggcgccaaatgagctgcagcaatttttt
attgatctcaagcagcttgtggaggacacatatgaggcaaataatcagactgccgtcact
ttcataacacacagcatgggcagcccgatgacgctggtcttcctgcagcagcagacgctg
gagtggaagacacgatatgtgcgaagacagataagcctcgctggcgcttgggcaggcagt
attaaggccgttaaggtgtatgccatgggcgatgatctggattcgtttgcattgagcgcc
aagattttgcgcgatgaacagatttcgcatccgtcaacggcatggctgttgccatcgcca
ctgttctggaagccatcggaagtgctggcgatgacgccatcaaagaattacaccatggca
cagctggagcagttctttacggatattgactacaagactggctgggagatgcgcaaggat
acgatgcgctatacacaaaactttagtccacccgatgttgagctgcattgcatctatggc
gacggcatcagcacagtcgaaagattgcaatacaaaaaggacaacattgccggagaaacc
cccaagttaattatgggcgtgggtgacggcaccgttaatcagcgttcgttgcgtgcctgt
caacactggtcaggccagtcaagctctcagatatccacactggccctgcaaggtgtcgat
cacatgggcgttctaacaaaccaggatgtctatcaatacatacgcactgttatgcaacag
ccataa

DBGET integrated database retrieval system