KEGG   Drosophila grimshawi: Dgri_GH11896Help
Entry
Dgri_GH11896      CDS       T01061                                 

Definition
GH11896 gene product from transcript GH11896-RA
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1312 aa AA seqDB search
MFAQLVQPNTEFPIADQLLLREAKHTNLPPEVGNDERLLHITPGTLSLDPKPHQVDIDQQ
ILELKKSQELQKQRLFNSYQEQTKQMELEHKMQLEHKYHFAVHSHGAFQELREQSMITAA
AVVEEQHRQQQQQQQQQQQQQQQQQQQQHHHHHQQQQQQQQQQQQQQRERREREVMKRKE
NCSANASPEVKQILSSFLMSRKSQAVAPNGTTTTSPYRNRGVVKSSSGESLPAGTVTSAH
PYKIPQPPASLLKYESDFPLRKTASEPNLLKIRLKQSVIERKARIGGPAGARRHERLLQA
AQRRHQKNSVLTNCNSTPDSGPNSPPSSTTLSVGVVGSRGSPTSAPIQEENEEGSQYQPG
QRSNINDLPLFSSPSLPNISLGRPHLSNAAQAGQANFVMFAALRQHVAATAAGAGGPSPV
NVGVGVGVAGTPPTYYNPLAMPFGRQPAPSLSMMPATGIAPQPSPVVRSASATSTSSSQA
SLVGDTAPPQAHAASTILPSSSSYMQLSGVGGANAVNLHAAAVAVAAAAAAAAAGTLPPT
NSHAHALYGHQQQHNAHPHPPHTHPHSHGHGHGHGHGGGGPGGPGAGAGGVPGAGHVPIT
DAQVAQVHLHKQGHRPLGRTQSAPLPLGHPMLTGAGQLNVVQTHYENSEAERQAYEHQVL
TQKLRQKVLTRSDAAAAVVAAIREPQLREEDDDDNAAVVMDLTDKKKPPKTVLTNTIATS
TSQNLPEALAAASYRAAAVAAAAAAAASTASAVGSKSSKQRDQEYLQQQRELLFLQQEEE
LTKGLMRPLSRTLSSPLVPGHGLSQIPDTGQHPTPIATSSSADHIPPVNLTLPHKRQLLG
NAYAAQLRQQQQQQQQQQQQQQQQSALLESSGPVGAHKKITTGLAYDPLMLKHACICGDN
ASHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTVHTEAHSMLFGSNQGQLTR
PKLESTLSASFVRLACGGLGVDLDTTWNEHHTATAARMAAGCVIDLAFKTARGDLRNGFA
VVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRVPDMKRILIVDWDVHHGNGTQQAFYQS
PDILYLSIHRHDDGNFFPGTGGPTECGAGAGIGYNVNISWSGALNPPLGDAEYIAAFRTV
VMPIAKCFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGLMTRELLQLANGKVVLALEG
GYDLTAICDSAQECVRALLGDPAAPIAQGELERPPCQNAINTLQKTIAIQQTHWPCVRLL
EHTVCLSALDALKIEHDESETVNAMAGLSMQTLHRTLSRDDSEEPMDQDETK
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgcaattagtccaacccaacacagaatttccaattgctgatcagctgctgctg
agagaggcgaagcacacaaatctgccaccggaggtcggaaacgatgagcgtttgttgcac
ataacgccaggcactttatcgctggacccaaaaccgcatcaagttgacattgatcagcag
atcctggagctaaaaaagagccaggagctgcagaagcagcgtctgtttaactcatatcag
gagcagacgaagcaaatggaactggagcataaaatgcaattggagcacaaatatcatttt
gcggtgcattcacatggcgctttccaggaattgcgggaacagagcatgatcacggcggca
gcagttgtcgaggaacagcatcgccagcagcagcagcaacaacagcagcagcagcagcag
cagcagcagcaacaacaacaacagcatcaccaccaccaccagcagcaacaacagcaacaa
caacaacaacagcagcagcagcgggagagacgcgagcgggaagtgatgaaacgcaaagag
aattgcagcgccaatgcgagtcccgaagtcaaacagatactcagtagctttcttatgagc
cgcaagtcacaggcagtggcaccgaatggcacaacaacaacatcgccatatcgcaatcgc
ggcgtggtaaagagctcctcgggtgaatcattgccagcgggcacggtgaccagcgcgcat
ccctataaaataccacagccgccagcctcactactcaaatatgaatctgattttccgctg
aggaagacggcatcggagcccaacctgctgaagatccgcctcaagcagagcgtcatcgag
cgcaaagctcgcatcggtgggccggcgggggcgcggcgacacgaacgcctgctgcaagct
gcccagcgtcgacatcaaaagaactcggttctcacaaattgcaacagcacaccggactcg
gggcccaattcgccgccatcgtcgacaacgttgtcggtgggcgtggttggcagcagaggg
tcaccgaccagcgcacccatccaggaggagaacgaggagggtagccaatatcagcccggc
cagcggagcaacatcaacgatctgcccctgttcagttcaccatccctgccaaatatatcc
cttggccgtccacatttaagcaatgcggcccaggctggccaggccaattttgttatgttt
gcggcactgcgtcagcatgtggcggcgacagctgccggtgccggcggtccatcgcccgtt
aacgttggtgttggcgtcggcgttgccgggacaccgcccacctactacaatccgctcgcg
atgccatttggccgacagccagcgccatcgctatcaatgatgccggcaactgggattgcg
ccacagccatcgccagttgtgcgttctgcatcggccacatcgacgtcctcgtcgcaggca
tcgctggtgggggatacggcgccgccgcaggcacatgctgcctccacaattctgccctcg
tcttcgtcctatatgcagctaagtggtgtcggtggtgccaacgctgttaatctccatgcg
gccgctgtggctgttgccgccgctgccgctgcagctgccgctggcacattgccgcccacc
aacagtcacgcccatgccctgtacggccatcagcagcagcataatgcacatccgcatccc
ccgcacacgcatccacacagccatggacatggccatggtcatggtcacggtggtggtggt
cctggtggtcctggtgctggtgctggtggtgttcctggtgctggccatgtgcccattacg
gacgcccaggtggcccaggtgcatctacacaaacagggccatcgaccgctgggacgcacc
cagtcggcaccgttgccactgggacatccgatgctaaccggcgccggccagctgaatgtg
gtgcaaacgcactacgagaatagcgaggcggaacgtcaggcgtacgagcatcaggtgctc
acccagaagctgcgacagaaggtgctgacgcgcagcgatgccgccgctgctgttgtggcc
gccatacgggagccgcagctgcgcgaggaggatgatgatgataatgctgctgtcgtgatg
gatctcaccgacaagaagaagccgcccaaaacggtgctgaccaacacaattgcgacgagc
acctcacagaatctgcccgaagcactggcagctgcctcgtatcgagcggcagctgttgct
gctgccgccgccgccgctgcttcaacagcgtcagcggtgggcagcaagtcgagcaagcaa
cgggatcaggagtatctgcaacagcagcgggaactgctctttctgcagcaggaggaggag
ctgaccaagggcctgatgcgtccgctatcgcgcacattgagcagcccgctggtgccgggc
catggcctcagccagatacccgatacgggacagcatccgacaccgattgccacatcctca
tcggccgatcacataccgcccgtcaatctaactctgccccacaagcgtcagttgctgggc
aacgcttatgccgcccaattgcgtcaacagcaacaacagcagcagcagcagcagcaacaa
caacaacaacagtctgcgctgctggagagtagcggtccagtgggagcgcacaagaagatc
acaacgggactggcatacgatccgctgatgctgaagcatgcctgcatttgcggtgacaac
gcatcgcatccggagcacagcggacggctgcagagcgtctgggcgcgtttgaatgaaacg
gatctggtgaagcgatgcgatcgattgcgtgcccgcaaggccacacaggaggagctgcag
acggtgcatacggaggcgcattcaatgttatttggctccaatcagggccagttgacgcga
cccaaactggagagcacactctccgcgagctttgtgcgcttggcatgcggcggcttgggt
gtcgatctggataccacatggaatgagcatcatacggcgaccgctgcccgtatggcagcc
ggctgtgttatcgatttggcctttaaaacggccagaggtgatctgcgcaacggtttcgcc
gtcgtccgtccgcccggccaccatgcggaggccaatctggccatgggcttctgttttttc
aattcgatcgccattgccgccaagctgttgcgccagcgtgtgcccgatatgaagcgcatc
ctcatcgttgattgggatgtgcatcatggcaatggcacacagcaagcattctaccaaagt
cccgacattctatatctttccatacatcgacacgatgatggcaacttctttcccggcacg
ggcggccccaccgagtgcggcgccggtgctggcatcggctataatgtgaatatctcctgg
tcgggcgcattgaatccaccgctgggcgatgccgaatatatcgctgcattccgtaccgtt
gtgatgcccattgccaagtgctttaatccggatattgtgcttgtctcgtcgggctttgat
gcggccaccggccatccagcgccacttggcggctatcatgtatccccggcatgctttggc
ctgatgacacgcgaactcctccagctggccaatggcaaggtggtgctggccctcgaaggt
ggctacgatctgacagcaatttgtgattcggcgcaagagtgtgtgcgcgccctgctcggt
gatccggcggcaccaattgcccaaggcgaattggagcgaccgccctgtcagaatgccatc
aatacgctgcagaagacgattgccatacagcaaacgcattggccctgtgtccggctgctg
gagcacaccgtctgcctgtctgcactggatgcgctcaagattgagcacgatgaatctgaa
acggtcaatgcaatggctggcctctcaatgcagacgttgcacagaacactttcgcgtgat
gattccgaggagcccatggatcaggatgaaaccaaatag

DBGET integrated database retrieval system