KEGG   Drosophila grimshawi: Dgri_GH11908Help
Entry
Dgri_GH11908      CDS       T01061                                 

Definition
GH11908 gene product from transcript GH11908-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dgri_GH11908
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dgri_GH11908
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH11908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1147 aa AA seqDB search
MDIDTDQSIEAMDTQDTQEVEIITSDLQQQQQQQQNQQQTNSPPQLPKFKNLIHPQLQQQ
QQQQPQQQQQQQQQQQQLPSENGNVPPQQLLAESSSTSFGNEQEIPMDEDAKEDQFRSET
TFSYTVENVGQIKQQHLSPPVYVRMLPWKIMVIPNDRALGFFLQCNGENDSPTWSCNAIA
ELRLKCHKADSPPFTRAKIKHLFYSKENDYGYSNFITWQELQDPDKYYVHNGSITLEVHV
IADAPHGVLWDSKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSTKS
VGLSLQRVFHELQFADRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTC
LEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYDSFQDYVASETLEG
DNKYDAGVHGLQEASKGVIFTSFPPVLHLHLMRFQYDPITDCSIKYNDRFEFYEQINLDR
YLAEREKTPADYVLHAVLVHSGDNHGGHYVVFINPKADGRWYKFDDDVVSSCRKQEAIEQ
NYGGMDDEISFHAKCSNAYMLVYIRQSELDRVLEDIPESEISSDLVERLDLEKRIEMARR
KERSEANLYVPIHVILEEYFEAQQKRRLFDVEKTHQRPFKLKQNQTVNEMVEMFVKAFGV
PRDRMRMWNMCTAQTQKFLYFDFEAEGARTIEQIPTSQKPWVIFLELAPPDSTGPLLPFN
PKTDVLLFLKYYDAPNKRLNYIGCTQQPLNRRLCELVPEINRKLGFELDTELTVFDEYAD
KKIPNINEPIESVLYMHQDHLQGPILIFERENVDVKLDLPTVEDYFLDLVYRIEIIFSDK
CNPNEPDFTLELSNRYNYDQLTNAVAERLNTDPQKLQFFMCISNFKETAGNAVPYTYKGN
IKDLLSYTKQSMPKRIFYQRLSLSIHELDNKKLFKCIWVSNDLKEEKELVLYPNKNGTVK
GLLDEAAKSITFAENSRKKLRLMKVGNHKIVAICKDDIPLDTLIKANESITTAQGTQKIY
RIEEIPNEETQLAENELLIPVAHYSKDLYNSFGVPFLIKARHNEPYGALKQRIQKRLNVP
DKEWENYKFAVIANGHTNDVNDNSPIDLEVYRTWTGGQMPFFGLDHINKSRKRSSLNFSE
KAIKIYN
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggacattgatacagatcagtctatcgaagcaatggacacccaagatacccaagaggtc
gaaataattacaagtgacctacagcaacagcaacaacagcaacagaatcaacaacagaca
aactcaccgccacaattgccgaaatttaagaatctaatacatccacagctgcaacagcaa
caacaacaacaaccgcaacagcagcaacaacaacaacagcagcagcagcagctacccagt
gagaacggcaacgtgccaccacagcaattattggcagagagcagctcgacatcgttcggg
aacgagcaggagataccaatggacgaggacgcaaaggaggatcaattccgttcggagaca
acattctcctataccgtggagaatgttggccagatcaagcaacagcatttgtcgccgccg
gtctatgtccgtatgctgccatggaagataatggttataccgaatgatcgagcattggga
ttctttctgcaatgcaatggcgagaatgattcgcccacctggtcgtgcaatgcaattgcc
gagctgcgactcaaatgccacaaggccgattcaccgccatttacacgggcgaaaatcaag
catttgttctactcgaaggagaacgattatggctattcgaattttataacatggcaggag
ctgcaggatcccgataaatactatgtgcacaatggtagcattacgcttgaggtgcatgta
attgccgatgctccgcacggcgtattgtgggactccaagaagcataccggctatgtgggc
ctcaaaaatcagggcgccacctgttatatgaactcactgctgcagacgctctattttacg
aactcgctgcgcttgagtgtctatcgcataccgaccgaggcggatgatagcaccaaatcg
gttgggttatcgctgcagcgtgtcttccatgagctgcagttcgctgatcgtcccgttggc
accaagaagctaacgaaatcgtttggttgggagacgctcgattcttttatgcagcatgat
gtacaggaatttctacgggtgctgctcgacaagctcgagtcgaagatgaagggcacgtgc
ctcgagggcaccattcctggcctgttcgagggcaaaatgtcatcgtacattaaatgcaag
aatgtcgactataatagcacacgctacgagaccttctacgacattcagctaaatatcaaa
gacaagaaaaatatctacgattcgtttcaggactatgttgcatccgagacacttgagggt
gacaacaaatacgatgccggtgtccatggtcttcaggaggcaagcaagggcgtcatattc
acatcattcccgccggtgctgcatttgcacttgatgcgtttccaatacgatccgataacg
gattgctcgatcaagtataacgatcgcttcgagttctatgagcaaatcaatctggaccgt
tatctggcggaacgtgagaagacaccggccgattatgtgctgcacgccgtattggtgcat
tcgggagacaatcacggcggccactatgtggtcttcatcaatccaaaagccgatggccgt
tggtataagttcgatgacgatgtcgtctccagttgccgcaaacaggaggcaatcgaacag
aactatggcggcatggatgatgaaatctcgtttcatgccaagtgcagcaatgcctatatg
ctcgtctatatacggcaatcggagctggatcgtgtactcgaggatatacccgagagtgag
atatccagtgatctggttgagcgtctcgatttggagaaacgcatcgagatggcacgtcgc
aaggagcgcagtgaggcgaatctttatgtgcccatacacgttatactcgaggagtacttt
gaggcacagcagaagcgacgtctcttcgatgtggagaagacacaccagcgcccgttcaag
ctaaagcaaaaccaaaccgttaacgagatggtcgagatgtttgtcaaggcatttggggtg
ccacgggatcggatgcgcatgtggaacatgtgcaccgcccaaacccaaaagttcctgtac
tttgacttcgaggcagagggtgcgcgcaccatcgaacagatacccacatcgcagaagccc
tgggtcatattccttgagctggcgccgcccgacagcactgggcccctgttgccgttcaat
cccaaaaccgatgtgctgctcttcctcaagtattatgatgcgcccaacaagcgtctcaat
tacattggctgcacacagcagccattaaatcgccgcctatgcgaactggtccccgaaatc
aatcggaagctcggctttgaactggacaccgagttgaccgtgttcgatgaatatgccgat
aagaaaatacccaacatcaatgagccaatcgagagtgtcctctatatgcatcaggatcat
ttgcaggggcccattttgatatttgagcgcgagaatgttgatgtcaaattggatctgcca
accgttgaggattactttttggatttggtctaccgcatcgagatcatcttcagcgacaaa
tgcaatcccaacgagccagacttcacactggagctatcaaatcgctacaactacgatcag
ctaacgaatgcggtagccgaacgactaaatacggatccacaaaagcttcagttcttcatg
tgcatcagcaacttcaaggaaaccgccggtaatgcggtgccctacacttacaagggcaac
atcaaggatctgctatcatacacaaagcagagcatgccgaagcgtattttctatcagaga
ctgtcgctcagcattcacgaactggataacaaaaagttgttcaaatgcatttgggtatcg
aatgatttgaaggaggaaaaggagctggtcctctatccgaataagaatggcacagttaag
ggactgttggatgaggcggccaaatcgatcacgtttgccgagaatagtcgcaaaaagttg
cgtctgatgaaggttggcaatcataagattgttgccatctgcaaggacgatataccattg
gatacgctaattaaggcaaacgaatcgataacaacagcccagggcacacagaaaatctat
cggatcgaggagatacccaatgaggagacacagctggcggagaatgagctactcataccg
gtggcacattacagcaaggatctctacaattcgttcggtgtgccatttctcataaaggcg
cgccacaacgaaccgtacggtgctctcaaacagcgcatacagaagcgcctcaatgtgccc
gacaaggagtgggagaattataagtttgctgtcattgccaatggtcacacaaacgatgtc
aatgataattcaccgatcgatttggaggtgtatcgcacatggacgggcggacagatgccg
ttctttgggctcgatcacattaacaagtcccgcaagcggagttcactcaacttttccgag
aaggcaatcaaaatctacaactaa

DBGET integrated database retrieval system