KEGG   Drosophila grimshawi: Dgri_GH11922Help
Entry
Dgri_GH11922      CDS       T01061                                 

Definition
GH11922 gene product from transcript GH11922-RA
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dgri_GH11922
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dgri_GH11922
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 937 aa AA seqDB search
MHPHQPSTINISSNQPTNPSQLQAGVRPERKQAIECIESLTGVSDLEVEKRKQRHRKLQL
QQQQQQQRQVERPQEIEEAYHMRCHKGNSVLKHDESSKDIEKENQMAERSKAQERRIYEL
DQNVERYFDVRKRLGKGAYGIVWKAIDKRQNNTVALKKIYDAFRDETDAQRTYREVAFLR
AFRPHPNIIRLLDIFKSSNNLDFYLVFEYMDSDLHNVIRKGNVLRAIHKRFVTYQLINAI
RYMHSGNVIHRDLKPSNILIDNKCRIKVADFGLARTLCVKRRTNSDYESKDELDSGVMLT
DYVATRWYRAPEILVASRRYTKGIDMWSLGCILAEMILQKPLFQGSSTINQIEKIVNALP
DVTERDIESIGATFGSILLSKKIVRDCRHSLDELIPYCCDDAMSLIKSLLVLDPDGRLTA
KESIAHPYVLRFRSSSATLELRTEVKPTLNDDIRYCVNDYRTRLYEMIAPELRASARHSS
ATPKTPVAPPTGSDVQPPAAALTHVIRAVSKTSSHHRSVASSCHAAGQTEFVTQSISNMT
KSWVDEQRKHHRQQQQFQKKHQPHQEQQQQLRPQLQLQQQQQQPQKHLPHLHRTNRNSNE
PNSQLRRTAAKELPTQMAPHREQLSAVGAATATVEQPVRVRKSRKESNQRRLDKIKRLIE
QTNTKSEQPAVAVATDNIEPQAEFQLNHLTMAHSQAIERMQSKAMQINVTLEQIKLEHQE
LVHNNYRNEVIHPQHKHFPHEQQNEELMDAAAYFCLNSRLRQLEDEMDKCKRQIFNYVQD
NQQVLHEQSLCTQIGQLLQPSSSSSTSTSTTSPPVNSSQCDSGVNQNPIAATGSNSMLKR
DKQKQLQFCEFLARDESNANAYEPPNLGNVYKFSQLHVHVQNDLAQSMASASSQRQLSST
LKKSTDCMPVQKDIRPVSRVYPNNLAFPGAQPHAREK
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgcacccacaccagccaagcactattaacatctcatccaaccaaccaaccaacccatcc
cagctgcaagctggcgtccgtccagaacgaaagcaagcaattgaatgtattgaaagtctc
actggtgtttcagacttggaggtggaaaagcggaaacagcgtcatcggaaactgcaattg
cagcagcaacagcagcagcagaggcaggttgagcggccgcaagagattgaggaggcttac
cacatgcggtgccacaaaggcaattcagttcttaagcacgacgagtccagcaaggatata
gaaaaagagaatcaaatggccgaacgatcaaaagctcaggagcgacgcatttatgagtta
gatcaaaatgttgagcgttattttgacgtgcgaaagcgcctgggcaaaggcgcctacggc
attgtatggaaagccattgacaagcgccaaaacaacactgtggcactcaagaagatctac
gatgcgttccgcgatgaaaccgatgcccaacgcacctatcgcgaagttgcctttctacgc
gcttttcgcccccatcccaacataatccgtctgctggatatattcaaatcgtcaaacaat
ttggacttttatttggtgtttgagtacatggacagcgatctacacaatgttatcagaaag
ggtaacgtccttagggccatacacaagcgattcgtcacctatcagttgatcaatgcgatc
agatatatgcactcgggcaacgtcatccacagggatctgaagccaagcaacattctgatt
gacaacaagtgcagaatcaaagtagccgactttggactggcgcgaactttgtgtgtaaag
cgacgcaccaactccgactacgaaagcaaggatgagctggacagtggagtcatgctgacc
gattatgtggcgacccgttggtatcgtgcacccgaaattttggtggccagtcgcagatat
acaaagggcattgatatgtggagtctgggctgcatactggccgagatgatactccagaag
ccgcttttccaaggtagcagcaccattaatcagattgagaagattgtgaatgcgctgccc
gatgtaacggaacgggatatcgaatcgatcggcgccaccttcggctcgattttgcttagc
aagaagattgtgcgggattgtcgccactccctggacgagctgataccgtattgctgtgac
gatgccatgtcgttgatcaaatcgctgctggtcctcgatccggatggccggctaacggcc
aaggagtcgatcgcccatccgtatgtgcttcgctttcgcagctcctcggcgaccctggaa
ctgcgcacggaggtcaaaccgacactcaacgatgatattcgctactgtgtgaatgattat
cgcacccggctgtacgagatgattgcgcccgagttgcgcgccagtgctcgccacagcagc
gccacaccaaagacccccgtagctccgccaactggctccgatgtacagccgccagcagcc
gctttgacgcacgtcatccgagccgtatcgaaaaccagttcacatcatagatctgtcgcc
agcagttgccatgcagctggacaaacagagttcgtcacgcagtctatatccaatatgact
aagagctgggtggatgagcagcgaaagcaccacagacagcagcagcaatttcaaaagaaa
caccaaccacatcaggaacaacagcaacaactgcgtccacagctgcagcttcagcagcag
cagcagcagccacaaaagcacttgccgcacctgcatcgtaccaaccggaattccaatgaa
cccaactctcagttgcgtcgcactgctgccaaggaactgcccacacagatggcgccgcat
cgggagcagctatccgctgtgggtgcagcaacagcaacggttgagcagccggtgcgtgtc
cgcaaatcgcgtaaggagtccaatcagcgacgtctggacaagattaaaaggttaatcgag
cagaccaatacgaaatcagagcagccagcagtagccgtggccacagataacatcgaaccg
caggccgagttccaattgaatcacttgacaatggcgcacagccaagccatcgagcgaatg
cagtcaaaagccatgcaaataaatgtaacattggagcagatcaagctggagcatcaggag
ctggttcacaataattataggaacgaagtgattcatccacagcataagcatttcccccac
gagcagcaaaatgaggagctgatggatgcagctgcctacttttgcctgaattcgcgtctg
cgccagctggaggatgagatggacaagtgcaagcgacagatctttaactatgtgcaggac
aatcagcaggtgcttcacgagcagagcctctgcacgcagatcggccaattgctgcagcca
tcgtcatcgtcatcgacatcaacatcgactacatcgccacctgttaactcatcgcaatgc
gattccggtgtcaaccagaatccaattgctgcaactggcagcaattcaatgctgaagcgc
gacaaacagaagcagttgcagttttgcgagtttctcgcacgcgacgagagcaatgccaat
gcctacgagccacccaatcttggcaacgtctacaagttcagccagttgcatgtccatgtc
caaaacgatctggcccaatctatggcctcagcatcttcgcaacgacaattgtcgtcaacc
ctcaagaagagcaccgactgtatgcccgtccagaaggacattcgtccggtgtcgcgagtg
tatcccaataatttggcgtttccaggcgcacagcctcacgcgagagagaagtag

DBGET integrated database retrieval system