KEGG   Drosophila grimshawi: Dgri_GH12072Help
Entry
Dgri_GH12072      CDS       T01061                                 

Definition
GH12072 gene product from transcript GH12072-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dgr  Drosophila grimshawi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dgri_GH12072
Enzymes [BR:dgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dgri_GH12072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 271 aa AA seqDB search
MSSQQRTVIIFKSESESTDVYAETLLGHNFRPLFVPTLSFGFKNLEQLSAKLQTPDKYAG
IIFTSPRCVEAVAESLQLAELPGGWKLLHNYAVGEVTHNLAMSTLQQLFTHGKQTGNARN
LGDFIVDTFDGSRNLPLLLPCGNLATDTLLSKLAENGFCVDACEVYETKCSPQLAECMER
ALKAENIEFLAFFSPSGVNCANEYFKAHNIAPNQWKLVAIGPSTRRALESLGLKVFCTAE
RPTVEHLVKVLLNPQESRERLVRDMEHKDLA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagcagcggacggtgattattttcaaatcagaatcggaaagtacagatgtg
tatgcggagaccttgctgggtcacaattttcggccactgttcgtgccgacactgagcttc
ggtttcaagaatcttgagcagctgagcgccaagctgcagacgccggacaaatatgctggc
atcatctttacaagtccacgttgcgtggaagcggtggccgagtccctgcagctggccgag
ctgcccggtggttggaaactgttgcataactatgccgtcggcgaggttacgcacaatctg
gcgatgagcacactgcaacagctcttcactcatggcaaacagacgggaaacgcacgcaat
ttgggcgatttcattgtggacacgttcgatgggtcgagaaatttgccgctgctgttaccg
tgcggcaatctggctacggacacattgctctccaagctggcggagaacggtttctgtgtg
gacgcctgcgaggtgtacgagacaaagtgcagtccccagctggccgagtgcatggagcgt
gctttgaaggcggagaacattgagtttctcgccttcttctcgccgtcgggtgtcaactgt
gcgaatgagtacttcaaggcgcacaacattgcaccgaatcagtggaagctggtggcaatt
gggccgagcacgcggcgagccctcgaatccctaggactaaaggtcttttgcaccgctgag
cgaccgactgtggagcatttggtgaaggtgctgcttaatccgcaggaaagtcgcgagcgc
ttggttcgcgacatggaacacaaggatctagcctaa

DBGET integrated database retrieval system