KEGG   Drosophila grimshawi: Dgri_GH12078Help
Entry
Dgri_GH12078      CDS       T01061                                 

Definition
GH12078 gene product from transcript GH12078-RA
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 385 aa AA seqDB search
MDTPRRKLRNLHMENVQNNSTPIKIPPSPMLKTLGHGTGVSVYRLDRSPKLGNIRSPWAV
KRITQRTRVKKDPIYNERIIHEAAILRTLNHPNIVGFRGVYKSLEGVDALALEMCSTSLG
SILEERHDEDLGPLPAKHTFKMIMDIAHALDFLHTEARLLHGDLKSFNVLVKGEFEICKL
CDFGVTLPLDENGEINFNKHPQVQYVGTALWSPPEVMDGVDIIDSKADIFSFGLTIYETL
ALVPPHTLELDAAFGSSSGAVIDLDSQEPAMPQRKQMNLTDNSIREDKAHECVDNNATDD
SVEDEDEDDTKENDISDFSLTHVEQAYGTRPPLPVAFQLSDDYNCIVELFYLCTNAHSED
RPAARTIWKCFENNAASVLGDAVND
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccacgtcgtaaactgcgcaatctgcacatggagaatgtgcagaacaacagc
acacccataaaaataccaccatcaccgatgctcaaaacacttggacatggcaccggcgtc
agtgtctaccgtttggacaggtcacccaaactgggtaacatacgttcgccgtgggccgtt
aaacgcatcacccaacgtacccgagtcaaaaaggatcccatttacaatgagcgcatcata
cacgaagcagccattttgcgcacactgaatcatccaaatattgttggctttcgtggcgtc
tacaagtcattggagggtgtggacgcattggcattggaaatgtgcagcacatcgctgggc
tccattttggaggagcggcacgatgaggatcttgggccgttgcccgccaaacacacattc
aaaatgataatggacattgcgcatgccttggactttctgcataccgaggcgcgcctgctg
cacggcgatctaaagtccttcaatgtgctcgtcaagggcgaatttgagatatgcaaattg
tgcgattttggcgtcacactgcccctggacgagaacggtgagatcaactttaacaagcat
ccgcaggtgcaatatgtgggaacggctttgtggtcaccgccggaggtaatggatggtgtg
gatatcattgacagcaaagcagacattttcagttttggcttaaccatctacgagacactg
gcgctggtccctccacacacactcgagctggacgccgcatttggcagcagcagcggcgcc
gtcatcgacttggactcacaagagccggcgatgccgcagcgcaagcaaatgaatctaaca
gataattccataagggaggacaaggcgcacgagtgcgtcgataataatgccactgatgac
tcggtagaagatgaggatgaggatgataccaaagagaatgatatctctgatttttcactg
acccatgtggagcaggcatatggaacacgaccgccgctgccggttgcctttcagcttagc
gatgattacaactgcattgtggagctgttctatttgtgcaccaatgcacacagtgaggat
cggcccgctgcacgcaccatctggaagtgctttgagaacaatgcggcaagtgttctcggc
gatgcagtgaatgactaa

DBGET integrated database retrieval system