KEGG   Drosophila grimshawi: Dgri_GH12117Help
Entry
Dgri_GH12117      CDS       T01061                                 

Definition
GH12117 gene product from transcript GH12117-RA
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dgr  Drosophila grimshawi
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dgri_GH12117
   04150 mTOR signaling pathway
    Dgri_GH12117
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dgri_GH12117
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dgri_GH12117
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dgri_GH12117
Mitochondrial biogenesis [BR:dgr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dgri_GH12117
  Mitophagy factors
   Other mitophagy factors
    Dgri_GH12117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 589 aa AA seqDB search
MPQMRAAAAEAAAAGNANPQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRLKVAVKILN
RQKIKSLDVVSKIKREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPSLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRATIEEIKKHEWFQKELPAYLFPSSIEQDSNVI
DTYAVSEVCTKFGVKESEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAATQISEINNFF
VAGSPPPATQLTHSTHEPRTSGAEPIATVFVGGGTAASSGSATPVHNGPMGGSVATSGIA
VPTIRPHPERIAPMRERQLAMSVQNTGGAAFPEKTARGGTPIKRAKWHLGIRSQSKPNDI
MLEVYRAMKALNYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTND
EVEQGDDVIMESLTPPPMSVSGTMPMQPTGHHTMEFFEMCAALIIQLAR
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccacagatgagagccgctgccgctgaggcggctgcagcgggcaatgcgaaccctcag
ccgctggtgaagatcggacactatctgcttggtgccacactcggcacgggcacctttggc
aaggtgaaaattggcgagcatcaaatcacacggctgaaggtcgccgtcaagatactcaat
cgccagaagatcaagagtctcgatgttgtctccaaaatcaagcgagagatccaaaatctc
aaactcttccggcatccgcacatcattaagctataccaggtcatctcaacaccatcggat
atattcatgataatggagtatgtcagcggcggcgagctgttcgattatattgtgaagcat
ggaaagctgcaggagcatcaggcgcgacgcttcttccagcagatcatatcgggcgtggac
tattgccatcggcacatgatcgtccacagggatctgaagccagagaatctgctgctcgat
cacaatatgcacgtgaaaattgccgacttcggtctgtccaatatgatgctggacggtgag
tttctgcgcacatcatgcggctcaccaaattatgcagcgcccgaggtgatatcgggcaaa
ctgtatgccggtcccgaggtggacatctggtcgtgtggcgtcatactgtatgcgctgctg
tgcggcactctgccgttcgatgatgagcatgtgccatcgctgttccgcaagattaagtcg
ggcatctttccgatacccgaatatctcaataagcaggtggtcaacttggtgtgccagatg
ctgcaggtggatccgctgaagcgtgccaccatcgaggagatcaagaagcacgagtggttc
caaaaggagctgcccgcctatctattcccctcatcgatcgagcaggactcgaatgtcatc
gatacgtacgccgtctccgaggtctgcaccaaatttggcgtcaaggagtccgaggtgcac
aattcattgctcagcggtgatccgcacgatcagctggcaatcgcctatcatctgatcatc
gataataaacgtttcgccgatgatgccgccacacaaattagcgagataaataactttttt
gtggccggctcaccgccaccggcaacacaattgacgcactccacccacgagccgcgcacc
agcggcgctgagccgatcgccaccgtttttgttggtggcggcacagctgccagttcgggc
agtgcaacgcccgttcacaacggtccaatgggtggcagcgttgccaccagcggcattgca
gtgccaaccatacggccacatcccgaacggatagcaccgatgcgcgaacgccagctggcc
atgtctgtgcagaatacgggtggcgccgcctttcccgagaagacagcgcgcggcggcaca
ccaattaagcgggccaaatggcatctaggcatacgatcgcagagcaagccgaacgacatc
atgctcgaggtatatcgggcgatgaaggcgctcaactacgagtggaagatcatcaatccg
tatcatgtccgtgtccggcgccagaatgtgaagactggcaaattttcgaaaatgtcgctg
cagctttatcaagtggatgcgaagagctatctgcttgactttaagtcgctgaccaacgat
gaggtcgaacagggcgacgatgtcatcatggagagcctaacgccgccaccgatgagcgtc
agcggcacaatgcccatgcagccaacgggccaccacaccatggagttctttgagatgtgt
gccgcactcatcatacagctggcgcgttaa

DBGET integrated database retrieval system