KEGG   Drosophila grimshawi: Dgri_GH12403Help
Entry
Dgri_GH12403      CDS       T01061                                 

Definition
(RefSeq) GH12403 gene product from transcript GH12403-RA
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00600  Sphingolipid metabolism
dgr01100  Metabolic pathways
Module
dgr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dgri_GH12403
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     Dgri_GH12403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 6565471
NCBI-ProteinID: XP_001990910
FlyBase: FBgn0119882
UniProt: B4JIX0
AA seq 700 aa AA seqDB search
MTAKTDHQTKGQQSETDTDANMDANMDVERLDVQQQPILQQLQTESTTTAKQSEQSQLIG
IFFVENRRRKQDIKIVVKLCADGIYLRRETTNSNHINEQLIRIEDIVGSSYGQRVKKRAR
GGLNSCKSASREPSENEPQNDQLEPEQAKGQADNSAYLYIYAYLKKEKPFRRVQTLRILR
FRTSDDYAENLNTARLWHRRIREHKQRSVTTPDGVIVGQGAGGKKLLILLNPKSGSGKGR
ELFQKQVAPLLSEAETQYDLQITTHPQYAQEFVRTRKDLLERYDGIVVASGDGLFYEVLN
GLMERMDWRRACRELSLGIIPCGSGNGLAKSIAHHCNEPYEPKPILHATLICVAGRTTPM
DVVRVELNHRDKHFVMYSFLSIGWGLIADIDIESERLRSIGAQRFTLWAIRRLITLRCYP
GKLYYLPAKSSKTNHTDTTAAARVARAPQTDRSSPEPPPVEQSNHRLAPRRSTAHEKSEF
RDLPDDDDNDVQLRDYCHSQFDEYVDALSTDRCSYRQNADSWHSAVSRRTAYFSLGGHST
RSNRSRLSVAQRIESANAEFNQLVPTATMPGLLLPLPAEQGWLSEEGEFVMVHAAYTTHL
ASDCFFAPDSRLNDGLIYLVIIRSGVGRSQLLNFLLSMQRGSHLPAEQDPYIQVMPVRAF
RIEPSGSNGILTIDGERVDYGPIQAEVFPGLINVMTSTGQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaaaaccgatcatcagaccaaaggtcaacagtcggagacggatacggatgcg
aatatggatgcaaatatggatgtggagagattagatgtgcaacaacaaccaatactacaa
cagctgcaaacagaatcaacaacgacagcaaaacaatctgagcagtcgcagctaattggc
atattctttgtggagaatcgaagacgcaagcaggatatcaaaattgtggtcaaactgtgc
gcggacggcatctatttgcggcgcgagacgacaaatagcaaccatatcaatgagcagctg
atacgcatcgaggacatcgttgggtccagctacggccagcgtgtgaagaagcgtgcccgc
ggcggcctcaactcctgcaagagtgccagccgcgagccgtcagagaacgagccgcagaac
gaccaactggagccagagcaggccaaaggtcaagcggataacagcgcctatttgtacatc
tatgcgtatctgaagaaggagaaaccgtttcgccgtgttcaaacattacgcatcttacgc
ttccgcaccagcgatgactatgctgagaatctgaacaccgcccggctctggcatcgcagg
atacgcgagcataaacaacgatccgtgacgacgccggatggcgtgatagtgggtcaaggt
gctggtggcaaaaagctgctcatattgctgaatccaaagtcgggatcgggcaagggacgc
gaactgtttcagaaacaggtggcgccattgttgagcgaagcggagacacaatatgatcta
caaatcacaacgcatccacagtatgcccaggagtttgtgcgcactcgtaaggatctattg
gaacgttatgatggcattgtagtcgcctccggcgatggtctattctatgaagtgcttaat
ggcctgatggagcgcatggactggcgtcgtgcatgtcgcgaactatccctgggtatcata
ccatgcggctcgggcaatggcctggccaaaagcattgcccatcactgcaacgaaccatac
gaaccgaagcccatactccatgcaacactgatctgtgtggccgggcgtaccacaccaatg
gatgtggtgcgcgtcgagctgaaccatcgggataagcattttgtgatgtactcattccta
tcgatcggctggggacttatcgccgacattgacattgagagcgagcgattgcgctcgatt
ggcgcccaacgttttacactgtgggccatccggcgtctcatcacgctacgctgctatccg
ggcaaactgtactatctgcctgccaagagttctaaaacaaatcacacagacacaacagca
gcagcaagagtagcaagagctccacaaacagaccgatcctcaccggaaccaccacctgtg
gaacagagcaatcacagattagcaccacgtcgatccactgcgcatgagaagagtgaattt
agagacctgcccgacgacgacgacaacgatgtgcagctgcgcgactattgccattctcaa
tttgatgagtatgtcgatgcgctgtcgacggatcgttgcagctatcgccagaatgcagac
agctggcattcggcggtatcgcgtcgcaccgcctacttctcgcttggtggtcacagcaca
cgctccaatcgaagtcgattgagcgtggcgcagcggatcgagtcggccaatgccgagttt
aatcagctcgtgccaacggccacaatgccaggcctactgctgccgctgcccgctgagcag
ggctggctgtcggaggaaggggagtttgtgatggtgcatgcggcatataccacgcatttg
gcatcggattgcttttttgccccggactcccggctgaacgatggtctcatttatctggtt
attatacggtctggagtcgggcggtcgcaacttctcaattttctgctgagcatgcagaga
ggctcacatttgccggcagaacaagatccctacattcaggtgatgccagtgcgtgcgttt
cgaatcgagccgagcggctccaatggcatcctaaccatcgatggagagcgcgtcgactat
ggacccatccaggctgaagtatttcccggtctgatcaatgtcatgacctctacgggccaa
tga

DBGET integrated database retrieval system