KEGG   Drosophila grimshawi: Dgri_GH12403Help
Entry
Dgri_GH12403      CDS       T01061                                 

Definition
GH12403 gene product from transcript GH12403-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dgr  Drosophila grimshawi
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dgri_GH12403
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Dgri_GH12403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 700 aa AA seqDB search
MTAKTDHQTKGQQSETDTDANMDANMDVERLDVQQQPILQQLQTESTTTAKQSEQSQLIG
IFFVENRRRKQDIKIVVKLCADGIYLRRETTNSNHINEQLIRIEDIVGSSYGQRVKKRAR
GGLNSCKSASREPSENEPQNDQLEPEQAKGQADNSAYLYIYAYLKKEKPFRRVQTLRILR
FRTSDDYAENLNTARLWHRRIREHKQRSVTTPDGVIVGQGAGGKKLLILLNPKSGSGKGR
ELFQKQVAPLLSEAETQYDLQITTHPQYAQEFVRTRKDLLERYDGIVVASGDGLFYEVLN
GLMERMDWRRACRELSLGIIPCGSGNGLAKSIAHHCNEPYEPKPILHATLICVAGRTTPM
DVVRVELNHRDKHFVMYSFLSIGWGLIADIDIESERLRSIGAQRFTLWAIRRLITLRCYP
GKLYYLPAKSSKTNHTDTTAAARVARAPQTDRSSPEPPPVEQSNHRLAPRRSTAHEKSEF
RDLPDDDDNDVQLRDYCHSQFDEYVDALSTDRCSYRQNADSWHSAVSRRTAYFSLGGHST
RSNRSRLSVAQRIESANAEFNQLVPTATMPGLLLPLPAEQGWLSEEGEFVMVHAAYTTHL
ASDCFFAPDSRLNDGLIYLVIIRSGVGRSQLLNFLLSMQRGSHLPAEQDPYIQVMPVRAF
RIEPSGSNGILTIDGERVDYGPIQAEVFPGLINVMTSTGQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaaaaccgatcatcagaccaaaggtcaacagtcggagacggatacggatgcg
aatatggatgcaaatatggatgtggagagattagatgtgcaacaacaaccaatactacaa
cagctgcaaacagaatcaacaacgacagcaaaacaatctgagcagtcgcagctaattggc
atattctttgtggagaatcgaagacgcaagcaggatatcaaaattgtggtcaaactgtgc
gcggacggcatctatttgcggcgcgagacgacaaatagcaaccatatcaatgagcagctg
atacgcatcgaggacatcgttgggtccagctacggccagcgtgtgaagaagcgtgcccgc
ggcggcctcaactcctgcaagagtgccagccgcgagccgtcagagaacgagccgcagaac
gaccaactggagccagagcaggccaaaggtcaagcggataacagcgcctatttgtacatc
tatgcgtatctgaagaaggagaaaccgtttcgccgtgttcaaacattacgcatcttacgc
ttccgcaccagcgatgactatgctgagaatctgaacaccgcccggctctggcatcgcagg
atacgcgagcataaacaacgatccgtgacgacgccggatggcgtgatagtgggtcaaggt
gctggtggcaaaaagctgctcatattgctgaatccaaagtcgggatcgggcaagggacgc
gaactgtttcagaaacaggtggcgccattgttgagcgaagcggagacacaatatgatcta
caaatcacaacgcatccacagtatgcccaggagtttgtgcgcactcgtaaggatctattg
gaacgttatgatggcattgtagtcgcctccggcgatggtctattctatgaagtgcttaat
ggcctgatggagcgcatggactggcgtcgtgcatgtcgcgaactatccctgggtatcata
ccatgcggctcgggcaatggcctggccaaaagcattgcccatcactgcaacgaaccatac
gaaccgaagcccatactccatgcaacactgatctgtgtggccgggcgtaccacaccaatg
gatgtggtgcgcgtcgagctgaaccatcgggataagcattttgtgatgtactcattccta
tcgatcggctggggacttatcgccgacattgacattgagagcgagcgattgcgctcgatt
ggcgcccaacgttttacactgtgggccatccggcgtctcatcacgctacgctgctatccg
ggcaaactgtactatctgcctgccaagagttctaaaacaaatcacacagacacaacagca
gcagcaagagtagcaagagctccacaaacagaccgatcctcaccggaaccaccacctgtg
gaacagagcaatcacagattagcaccacgtcgatccactgcgcatgagaagagtgaattt
agagacctgcccgacgacgacgacaacgatgtgcagctgcgcgactattgccattctcaa
tttgatgagtatgtcgatgcgctgtcgacggatcgttgcagctatcgccagaatgcagac
agctggcattcggcggtatcgcgtcgcaccgcctacttctcgcttggtggtcacagcaca
cgctccaatcgaagtcgattgagcgtggcgcagcggatcgagtcggccaatgccgagttt
aatcagctcgtgccaacggccacaatgccaggcctactgctgccgctgcccgctgagcag
ggctggctgtcggaggaaggggagtttgtgatggtgcatgcggcatataccacgcatttg
gcatcggattgcttttttgccccggactcccggctgaacgatggtctcatttatctggtt
attatacggtctggagtcgggcggtcgcaacttctcaattttctgctgagcatgcagaga
ggctcacatttgccggcagaacaagatccctacattcaggtgatgccagtgcgtgcgttt
cgaatcgagccgagcggctccaatggcatcctaaccatcgatggagagcgcgtcgactat
ggacccatccaggctgaagtatttcccggtctgatcaatgtcatgacctctacgggccaa
tga

DBGET integrated database retrieval system