KEGG   Drosophila grimshawi: Dgri_GH12793Help
Entry
Dgri_GH12793      CDS       T01061                                 

Definition
GH12793 gene product from transcript GH12793-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dgr  Drosophila grimshawi
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dgri_GH12793
   04068 FoxO signaling pathway
    Dgri_GH12793
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dgri_GH12793
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dgri_GH12793
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dgri_GH12793
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 398 aa AA seqDB search
MSKNKLNLVLPPVNVDAAVATTQVAPTPPFKTPSGTETHSLLGKPKASSIDALTETLEGL
DMDDTERKRIKVFLSQKEKIGELSEEDLEKLGELGSGNGGVVMKVRHTLTNLIMARKLIH
LEVKPAIKKQILRELKVLHECNFAHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGR
IPESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMA
NSFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPEASALETIFAENAN
EDGSQATLEPKVMAIFELLDYIVNEPPPKLEHKIFSNEFKDFVDICLKKQPDERADLKTL
LSHAWIRKAEVEDVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaaataaactaaacttagtgctgccgccggtaaatgtggatgcagctgttgcc
accacacaggtggcaccaacaccgccattcaaaacgccatcgggaacagaaacacacagc
ttgctgggaaagccaaaagcatcgagcatcgatgcattgaccgaaacgttggagggcctg
gacatggacgacaccgaacgcaagcgaatcaaagtgttcctcagtcagaaggagaagatc
ggcgaactgtccgaagaggatctggaaaagttgggtgaactcggctccggcaatggcggc
gttgtgatgaaagtgcgacacaccctcacaaatctgataatggcgcggaaactcatccat
ctggaggtgaaaccagcgatcaagaagcaaatcctgcgcgagctaaaagtccttcacgaa
tgcaattttgcgcacattgttggcttctatggtgccttctatagcgatggtgagataagc
atttgcatggaatacatggacggcggctccctcgatctcatcctaaagcgagccggccgc
atacccgaatcgatactcggacgcatcacgctagcggtgctgaagggactcagctatctg
cgcgacaagcatgcgatcatccatcgggatgttaagccaagcaatatactcgtcaacagc
agcggcgagatcaaaatctgtgattttggcgtttcgggtcagcttattgactcgatggcc
aactcatttgttggcacgcgcagctacatgtcgccggaacgattgcagggcactcactat
tcggtacagtccgacatttggtctctgggcttgtcgctagttgagatggcaatcggaatg
tatccaatcccgccgccggaagcctctgcgctggagaccatatttgctgagaatgccaat
gaagatggcagccaagcgacgctagagcccaaagtgatggcaatattcgagctgctcgac
tatattgttaacgagccgccacctaagctggaacacaagatattctccaacgagttcaag
gactttgtcgacatatgcctcaaaaagcagccggacgagcgtgccgatctcaaaacatta
ctgagccatgcatggatacgcaaggcggaggtggaagatgtcgacatatcgggatgggtg
tgcaagacaatggatttaccaccatcgacgccaaaacgcaatacctcgcccaactaa

DBGET integrated database retrieval system