KEGG   Drosophila grimshawi: Dgri_GH12828Help
Entry
Dgri_GH12828      CDS       T01061                                 

Definition
(RefSeq) GH12828 gene product from transcript GH12828-RA
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
dgr  Drosophila grimshawi
Pathway
dgr00010  Glycolysis / Gluconeogenesis
dgr00020  Citrate cycle (TCA cycle)
dgr00620  Pyruvate metabolism
dgr01100  Metabolic pathways
dgr01200  Carbon metabolism
Module
dgr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH12828
   00020 Citrate cycle (TCA cycle)
    Dgri_GH12828
   00620 Pyruvate metabolism
    Dgri_GH12828
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Dgri_GH12828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh DXP_synthase_N TFIIE-A_C
Motif
Other DBs
NCBI-GeneID: 6564638
NCBI-ProteinID: XP_001991752
FlyBase: FBgn0120307
UniProt: B4JLC4
AA seq 399 aa AA seqDB search
MLRTLSRVSELPIVVKQLQKNAAQSGVAKTNNYATEATVQVNRPFKLHRLDEGPEMTVQL
TKEEALKYYTQMQTIRRIETSAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDNIIS
AYRVHGWTYLMGVSPLGVLAELTGMKSGCARGKGGSMHMYSPNFYGGNGIVGAQVPLGAG
VGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERA
SCNTDYYTRGDALPGIWVDGMDVLAVRSATEFAIKYVNTHGPLVMETNTYRYSGHSMSDP
GTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATALAKSDT
ELPLSHLWTDVYSHNLEKKIRGTNGFDIDHIQERKGVNH
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtacattgtcacgcgttagtgaattgccaattgttgtaaaacaattgcaaaaa
aatgcagcacagtctggtgtcgcaaagaccaacaactatgccacggaggcgaccgtgcag
gttaatcggccgtttaaactgcatcggctggacgagggacccgagatgacagtgcagctg
accaaggaggaggcactcaaatactatacacaaatgcaaacgatacgacgcattgagaca
tccgctggcaatctgtacaaggagaagatcatacgcggcttttgccatctgtattcgggc
caggaggcgtgcgccgttggcatgaaggcggcgatgcgcgatgtcgataacataatatcc
gcctatcgtgtgcatggctggacctatctgatgggtgtatccccgctgggtgtcctcgcc
gaactgacgggcatgaagagcggttgtgcacgcggcaagggcggctctatgcacatgtat
tccccaaatttctatggcggcaacggcattgtcggagcccaagtgcccctcggcgccggc
gttggcctcgcctgcaaatacaagggcaacggcggcatgtgcctggctctatatggcgat
ggtgctgccaatcagggacaggtctttgaggcctataacatggcttatctgtggaagctg
ccggtcatctttgtctgcgagaacaacaactatggcatgggcaccagctcggagcgcgct
tcgtgcaacacggattattatacgcgcggcgatgctctgcccggcatttgggtggacggc
atggatgtgttggctgtgcgcagtgccaccgagtttgccatcaagtatgtgaacacacat
gggccactggttatggagacgaatacttatcggtattcgggacattcgatgtccgatcct
ggaacatcgtatcgtacgcgcgaggaaatccaggaggtgcgccagaagcgtgatccgatt
acctccttcaaggagctgtgcattgagctgggcctcattaccaccgatgaagttaaggcc
attgatctgaaggtgcgcaaggaagtggatgaagctactgccttggccaagtccgacact
gagctgccccttagccatttgtggaccgatgtctactctcataatttggagaaaaagata
cgcggcactaacggtttcgatatagatcacatccaggagcgtaagggtgtcaatcactaa

DBGET integrated database retrieval system