KEGG   Drosophila grimshawi: Dgri_GH12828Help
Entry
Dgri_GH12828      CDS       T01061                                 

Definition
GH12828 gene product from transcript GH12828-RA
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
dgr  Drosophila grimshawi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgri_GH12828
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH12828
   00020 Citrate cycle (TCA cycle)
    Dgri_GH12828
   00620 Pyruvate metabolism
    Dgri_GH12828
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Dgri_GH12828
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 399 aa AA seqDB search
MLRTLSRVSELPIVVKQLQKNAAQSGVAKTNNYATEATVQVNRPFKLHRLDEGPEMTVQL
TKEEALKYYTQMQTIRRIETSAGNLYKEKIIRGFCHLYSGQEACAVGMKAAMRDVDNIIS
AYRVHGWTYLMGVSPLGVLAELTGMKSGCARGKGGSMHMYSPNFYGGNGIVGAQVPLGAG
VGLACKYKGNGGMCLALYGDGAANQGQVFEAYNMAYLWKLPVIFVCENNNYGMGTSSERA
SCNTDYYTRGDALPGIWVDGMDVLAVRSATEFAIKYVNTHGPLVMETNTYRYSGHSMSDP
GTSYRTREEIQEVRQKRDPITSFKELCIELGLITTDEVKAIDLKVRKEVDEATALAKSDT
ELPLSHLWTDVYSHNLEKKIRGTNGFDIDHIQERKGVNH
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtacattgtcacgcgttagtgaattgccaattgttgtaaaacaattgcaaaaa
aatgcagcacagtctggtgtcgcaaagaccaacaactatgccacggaggcgaccgtgcag
gttaatcggccgtttaaactgcatcggctggacgagggacccgagatgacagtgcagctg
accaaggaggaggcactcaaatactatacacaaatgcaaacgatacgacgcattgagaca
tccgctggcaatctgtacaaggagaagatcatacgcggcttttgccatctgtattcgggc
caggaggcgtgcgccgttggcatgaaggcggcgatgcgcgatgtcgataacataatatcc
gcctatcgtgtgcatggctggacctatctgatgggtgtatccccgctgggtgtcctcgcc
gaactgacgggcatgaagagcggttgtgcacgcggcaagggcggctctatgcacatgtat
tccccaaatttctatggcggcaacggcattgtcggagcccaagtgcccctcggcgccggc
gttggcctcgcctgcaaatacaagggcaacggcggcatgtgcctggctctatatggcgat
ggtgctgccaatcagggacaggtctttgaggcctataacatggcttatctgtggaagctg
ccggtcatctttgtctgcgagaacaacaactatggcatgggcaccagctcggagcgcgct
tcgtgcaacacggattattatacgcgcggcgatgctctgcccggcatttgggtggacggc
atggatgtgttggctgtgcgcagtgccaccgagtttgccatcaagtatgtgaacacacat
gggccactggttatggagacgaatacttatcggtattcgggacattcgatgtccgatcct
ggaacatcgtatcgtacgcgcgaggaaatccaggaggtgcgccagaagcgtgatccgatt
acctccttcaaggagctgtgcattgagctgggcctcattaccaccgatgaagttaaggcc
attgatctgaaggtgcgcaaggaagtggatgaagctactgccttggccaagtccgacact
gagctgccccttagccatttgtggaccgatgtctactctcataatttggagaaaaagata
cgcggcactaacggtttcgatatagatcacatccaggagcgtaagggtgtcaatcactaa

DBGET integrated database retrieval system