KEGG   Drosophila grimshawi: Dgri_GH12913Help
Entry
Dgri_GH12913      CDS       T01061                                 

Definition
GH12913 gene product from transcript GH12913-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dgr  Drosophila grimshawi
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dgri_GH12913
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dgri_GH12913
Exosome [BR:dgr04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dgri_GH12913
  Exosomal proteins of breast milk
   Dgri_GH12913
Heparan sulfate/heparin binding proteins [BR:dgr00536]
 Enzymes (General comment) Variety
  Dgri_GH12913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 433 aa AA seqDB search
MPRHVNWRQRGQKQKQKQQSCHDFAWLWTSLLLLGSIWSTGAHFHKWKILQRSFRYMQET
MLRNSLERAHLNYGIVFECRTISDIDVGDDSHFDLQLGDLSGFRRLDDKKKLALFLHGWN
DQGSKEWVQELLFTWTLFDERYNVCVVDWGHLSQNDYKSASMSIFDVGLTVAGIIIALEE
MRPRQFNRQNVTLAGYSLGAHAAGYAGAVLDGRVEQIIGLDPAGPLFTLPAAVSPKYRLD
QTDAQYVQVMHTSSGTLGTSLKCGHADFYPNGGRAPQRNCQMFMSMSDMQNTNPIACSHS
TAAIFFRQSLDPQYPFMGYQCDSYRSYAAGRCANNLRARFGIHSHRRPEGSFYFDTISSH
PYVKRQRSVRLRNWDWEWELERERERNQNPGGRQMSEARSGDLLLGRLWRRTWQRRSRER
NRCPSSTGKDRLE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcacgtgaactggcggcagcgtggccaaaaacagaaacagaaacaacaaagc
tgccatgactttgcctggctgtggaccagtctgctgttgctgggcagcatctggagcacc
ggagcgcattttcacaaatggaaaatcctgcagagaagctttcgctacatgcaggagacg
atgctgagaaacagcttggaacgcgcgcatctcaactatggaattgtgtttgagtgccgc
accatctccgacattgatgtgggcgatgattcacacttcgatttgcagctgggcgacttg
agcggattccgtcgcttggatgacaaaaagaagttggccttgtttttgcatggctggaac
gatcaaggcagcaaggaatgggtccaggagttattgttcacctggacgctcttcgacgag
cgctacaatgtgtgcgttgtggattggggccatttgtcgcagaatgactacaaaagcgcc
tcgatgtccatattcgatgttggcctgacagtggcgggcataatcattgccctggaggag
atgcgtccgcgtcagttcaatcgtcagaatgtgacccttgcgggctatagtctgggtgct
catgcagctggatatgcgggcgctgtgctcgatggcagggttgagcaaattattggactg
gatccggctggaccgctgtttacattgccagcggctgtttcgcccaaatatcgtctggat
caaacggatgcacaatacgttcaggtcatgcacacctcgagcggcacattgggcaccagt
ttgaaatgtggccacgccgatttctatccgaacggtggccgagcaccccaacgaaattgt
cagatgtttatgagcatgagcgacatgcagaacacgaatcccattgcgtgcagccactcg
acggctgccatattcttcagacagtccctggatccgcaataccccttcatgggctatcag
tgtgatagctatcgcagctatgccgctggccgttgcgccaataatctgcgtgcccgcttt
gggattcactcgcatcgtcggccggagggcagcttctacttcgacaccatttcgagccat
ccgtatgtgaagcgacagcgttcggttcgcctgcgcaattgggattgggaatgggaactg
gaacgggaacgggaacggaatcagaatcctggtggccgtcaaatgagtgaagctcgttcc
ggagatcttctgcttggacgtctgtggcgacgcacctggcaaaggcggagtcgggaacgc
aatcgctgcccttcgagtactggcaaggatagattagagtag

DBGET integrated database retrieval system