KEGG   Drosophila grimshawi: Dgri_GH12913Help
Entry
Dgri_GH12913      CDS       T01061                                 

Definition
(RefSeq) GH12913 gene product from transcript GH12913-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 6564557
NCBI-ProteinID: XP_001991902
FlyBase: FBgn0120391
UniProt: B4JIT0
AA seq 433 aa AA seqDB search
MPRHVNWRQRGQKQKQKQQSCHDFAWLWTSLLLLGSIWSTGAHFHKWKILQRSFRYMQET
MLRNSLERAHLNYGIVFECRTISDIDVGDDSHFDLQLGDLSGFRRLDDKKKLALFLHGWN
DQGSKEWVQELLFTWTLFDERYNVCVVDWGHLSQNDYKSASMSIFDVGLTVAGIIIALEE
MRPRQFNRQNVTLAGYSLGAHAAGYAGAVLDGRVEQIIGLDPAGPLFTLPAAVSPKYRLD
QTDAQYVQVMHTSSGTLGTSLKCGHADFYPNGGRAPQRNCQMFMSMSDMQNTNPIACSHS
TAAIFFRQSLDPQYPFMGYQCDSYRSYAAGRCANNLRARFGIHSHRRPEGSFYFDTISSH
PYVKRQRSVRLRNWDWEWELERERERNQNPGGRQMSEARSGDLLLGRLWRRTWQRRSRER
NRCPSSTGKDRLE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcacgtgaactggcggcagcgtggccaaaaacagaaacagaaacaacaaagc
tgccatgactttgcctggctgtggaccagtctgctgttgctgggcagcatctggagcacc
ggagcgcattttcacaaatggaaaatcctgcagagaagctttcgctacatgcaggagacg
atgctgagaaacagcttggaacgcgcgcatctcaactatggaattgtgtttgagtgccgc
accatctccgacattgatgtgggcgatgattcacacttcgatttgcagctgggcgacttg
agcggattccgtcgcttggatgacaaaaagaagttggccttgtttttgcatggctggaac
gatcaaggcagcaaggaatgggtccaggagttattgttcacctggacgctcttcgacgag
cgctacaatgtgtgcgttgtggattggggccatttgtcgcagaatgactacaaaagcgcc
tcgatgtccatattcgatgttggcctgacagtggcgggcataatcattgccctggaggag
atgcgtccgcgtcagttcaatcgtcagaatgtgacccttgcgggctatagtctgggtgct
catgcagctggatatgcgggcgctgtgctcgatggcagggttgagcaaattattggactg
gatccggctggaccgctgtttacattgccagcggctgtttcgcccaaatatcgtctggat
caaacggatgcacaatacgttcaggtcatgcacacctcgagcggcacattgggcaccagt
ttgaaatgtggccacgccgatttctatccgaacggtggccgagcaccccaacgaaattgt
cagatgtttatgagcatgagcgacatgcagaacacgaatcccattgcgtgcagccactcg
acggctgccatattcttcagacagtccctggatccgcaataccccttcatgggctatcag
tgtgatagctatcgcagctatgccgctggccgttgcgccaataatctgcgtgcccgcttt
gggattcactcgcatcgtcggccggagggcagcttctacttcgacaccatttcgagccat
ccgtatgtgaagcgacagcgttcggttcgcctgcgcaattgggattgggaatgggaactg
gaacgggaacgggaacggaatcagaatcctggtggccgtcaaatgagtgaagctcgttcc
ggagatcttctgcttggacgtctgtggcgacgcacctggcaaaggcggagtcgggaacgc
aatcgctgcccttcgagtactggcaaggatagattagagtag

DBGET integrated database retrieval system