KEGG   Drosophila grimshawi: Dgri_GH12924Help
Entry
Dgri_GH12924      CDS       T01061                                 

Definition
GH12924 gene product from transcript GH12924-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dgri_GH12924
   04330 Notch signaling pathway
    Dgri_GH12924
   04350 TGF-beta signaling pathway
    Dgri_GH12924
   04630 Jak-STAT signaling pathway
    Dgri_GH12924
   04068 FoxO signaling pathway
    Dgri_GH12924
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH12924
Transcription factors [BR:dgr03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dgri_GH12924
Mitochondrial biogenesis [BR:dgr03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dgri_GH12924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3292 aa AA seqDB search
MADHLDEPPQKRVKMDPSDLFYSILEDNLPDELVSSNSGWSDQLNTGGGGGGVSVVATAT
GAGSGGPNKPPAQGPGPNVVPPQMNGAGGGGDDGSSNGGGGAAGNQLRQMQHHQHLQHLL
QQQQQGNKGAGGGMVVPGMNQLGSKSPNLQSPNTGGMQVATQMGMVNSMPMSISNNGNNG
MNTIPGMNSIAQGNLGNMVLTNSGGMGNIGGAGMVNALKQPGAASMMNAVPGVGSVPGSA
PNQGMHMQNGPMMGRMVGQQHMLRGPHLMGAGAGGGNGPGGVVGAGGGPRMQNPNMQLGQ
INNMPYGVGNYGAPGGANPQQQQQLLAQQMAQRGGGGVVAPNMSSGMPQGNRPIGTVVPM
SSLGGDGAPPGAGGLVGNPQQQQQQQLAAANAQMNPQQQQPGIQQGALGPRAPQPNQLLG
HAQQQQQQQQQQQQQQQQQQQQQQQPGTSQQQGVPSASPVSGTAPAQNSMSEERKKQIQQ
QLMLLLHAHKCNRRENLNPNREVCNVNYCKAMKAVLAHMATCKQSKDCTMQHCTSSRQIL
LHYKTCSRSDCIICLPFRQNQPPQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQLPQGQQVPQNASGVGVGVGVGVGVGVGVDGKQVAQSAGGTGGPQNTAIVLPQQQTPG
APNVPKTNTDMAQQLAQQQQQQQQQQHQQVELRRFEGVGSILPVGPVASGMLGAPTQGMP
PGIRMQGSPAVRVLGVQPGPGGSLPGGLPVPVSVPGQNVLPGANDVNSLQQQQQAQAAAQ
QGGQLMLQGCNIVGGRRRALPNMVEQQQQQQPNAQQNAQQQQQLGNIPAPLSVNVGFNNS
NFVGVGVNDKQQQQQQQQQQQQQLVGQSDQLAKLKLQAQAQAQVQAHGGNVVSAGGVPGA
GVAAGASVLMPADTTGGGNSSSVPGVTTGAGAGGGAGGPAGSGGDNEKDWRESVTADLRN
HLVHKLVQAIFPTSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQ
KELEEKRLKRKEQHQQQMLQMQQQGVPNSGAVVNPTSVVPNNTLQQQQQQQQQQQQQQQQ
QPGQGVRPIISPMGGGGVVPTGMMPQQLRPQAPGMGGGVVAGQQQTPAGQPNMVAVAASM
RSHSPGGNMLAIQQQQRMQFPQQQQPGQGNMLVGPPGPSPGGMAVLSPFTGLTSPVPGQQ
QQQQQQQQQQQQQQQQQQQQQQQQQFINANGGTGAQNPQLSEIMKQRLLQQHQQQTAAAM
LLPQSPFSNATPIPQQQQQQQQQQQQQQQPQQQQQQQQQQQQTNAFSSPMQQQKAQQPPG
SVLNNMPPTPTSLDALNAGAASAAAGAGGGGSSGNSGNGGSGAGAGTGAGSASGVVSSGT
VAAPSPSPSFMSNGPIGTPSNNPPSVSSLMQPLSNRATSPPYIPASPVPATSASGLATSS
TPASTAATCASSSSNGNGSNSSSAASSSSCTAITTTAITTSVSTPLSSASSSTATPTSTT
ASSGNGGSVPASSSTLLLMGRSSSENSAPVPNRMMSSSSSLSSQMAALEAAARDNDDETP
SPAGANDTNGSNGGSGGGGMSSKGKLDSIKQEDEIKKDFMDDSCGGNGDGSLMDCLTGGK
GKNVNNDGTSMVKIDLKSEDGADGDVKIKAEPMDVDDSATGSGIPGGANGDGTIGGSGID
SKDDIKGGIDGIASGGVGDIKIKCETKPIVPEPIAPNAGDKKKKCQFNPEELRTALLPTL
DKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRNNILNGKYSDPWEYVDDVW
LMFDDAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQL
CTIPRDAKYYSYQNSLKEYGVASNRYTFCQKCFNDIQGDTVTLGDDPVQSQTQIKKDQFK
EMKNDHLELEPFVDCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKR
LPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEGGEMMNEF
PYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAV
YHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDK
GMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEA
AEAAAAANLFSIEDNEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIY
ATMEKHKEVFFVIRLHSAQSAASLAPIQDPDPLLTCDLMDGRDAFLTLARDKHYEFSSLR
RAQFSTLSMLYELHNQGQDKFVYTCNNCKTAVETRYHCTVCDDFDLCTVCKEKVGHPHKM
EKLGFDLDDGSAPADLKQANPQEARKQSIQRCIQSLVHACQCRDANCRLPSCQKMKRVVQ
HTKNCKRKTNGGCPICKQLIALCCYHAKHCQEQKCPVPFCPNIKHKLKQQQLQQKLQQQQ
LLRRRVALMSRTAAPAALPGPTISGPVVAAGGVGVGVPVVGMSGVAVSQQVMSGQASILP
VGAGGMSPSTVTVPSPVSVMGGMTSPHPHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAAR
QQVPHVGSFGKGVPMAPPVMQRPMGVGVPNQGAMGGMVGNVGVNQLAGNVGVGPGVGQLP
SGANCNNVLNSNNLLPMEQWGGGGGGGVGPGQQRYANNTPNQSGMRQPNQLMQQNLQQQQ
QQQQMMGMPPNQMGGGVGVGVGVGAGQMPVVGGGVNMGGGGAPHGIGMGAPMGAAAAGGG
VRPPGAQGVGTGGGGAGGAGPNMGSGPPLNTQTLAQIMQKIKNNPTNESNQHILSILKQN
PQIMAAIIKQRQQSQINAAAGGAGGPVGALQAGNGPQTPQQQQQVMQQQQQMQHMLNQQQ
QQQGPGPGPQQMGPGQQQQVSLMQAQQQQQPGPPHQRMANMQNAAMMLPNLPSGLTSQGG
MVPNQKWNNMRYMQMNQYPPPYPRQRGPHMSGAGQQQFPGGTAGNFNAGGAGTVAGVPVA
GAPVGGSGSAGPGSDQYSMTNAAASNMLQQQQGGGGAGVKPGPQQQQQQQQQMGVMPPGM
QQQQPLQQQQQQQQQQMMQVVAAGGGGMTNANTQNAMPGGGGGPGGSSANVMGPPTPHTL
QQQLMQSARSSPPIRSPQPTPSPRSAPSPRGPSASPRAQPSPHHVMSHSPAPQGPHDGMH
NHGMHHQSPLPGVPQDVGVSGVGVGVNAGNVGNTGGALPDASDQLTKFVERL
NT seq 9879 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcatttggacgaaccgccacagaagcgggtaaaaatggatccatcggatcta
ttctattctattctggaagacaatctacccgatgagctggtgtcttcgaacagcggctgg
tcggatcagctaaacactggcggcggcggtggcggtgttagtgttgttgcgacagcaacc
ggcgccggcagtggcggaccaaataaaccaccagctcagggacccggtccaaatgtggtg
ccaccacaaatgaacggtgccggtgggggcggtgatgatggcagcagtaatggcggaggc
ggcgctgccggaaatcaactgcgacaaatgcaacaccaccagcatctgcagcatctgttg
caacaacagcagcagggcaataagggcgctggcggtggcatggttgtgcctggcatgaat
caacttggcagcaagtcacccaatttacaatcgcccaacaccggtggcatgcaggttgcg
acacaaatgggcatggtcaattcaatgcccatgtccatatcgaataatggcaacaatggc
atgaataccataccaggcatgaacagcattgcacagggtaacctgggcaacatggttctg
acaaacagcggcggcatgggtaacataggtggcgccggcatggtgaacgctctgaagcaa
ccgggcgctgcctcaatgatgaacgccgtgcccggcgtgggctcggtgcccgggtcagcg
ccaaatcagggcatgcatatgcaaaatggtccgatgatgggtcgcatggttgggcagcag
cacatgcttcgtggcccgcatctgatgggcgccggagctggcggcggtaatggaccaggt
ggtgttgttggcgccggcggtggtccacggatgcaaaatccaaacatgcagctgggccaa
atcaacaatatgccttatggagtcggcaactatggtgcacctggtggcgccaatccgcag
cagcaacaacagctgctggctcaacagatggcacagcgcggcggcggcggcgttgtggcg
ccgaacatgagctctggtatgcctcagggaaatcgaccaattggcacagttgtgcccatg
tccagtctgggcggagatggtgcgccacctggtgcaggtggactcgttggcaatcctcag
cagcagcagcagcagcaactggctgcggcaaatgcacaaatgaatccccagcagcaacag
ccgggcatccaacagggtgcactgggaccacgagcgccgcaacccaatcaactgcttgga
catgctcagcagcaacagcaacaacaacaacagcagcagcagcaacaacagcagcagcag
caacagcagcagcagcccggcacatctcagcagcagggagtaccctcagcgtcgcctgtt
agcgggactgctccggcgcagaatagcatgtccgaggagcgaaagaaacaaatacagcag
cagctgatgttgctgctgcacgcgcacaagtgcaataggcgcgaaaatctgaatcccaat
cgcgaggtatgcaacgtcaactattgcaaggcgatgaaagccgtcttggcgcatatggcc
acctgcaagcagagcaaggattgcaccatgcagcactgtacctcgtcgcgccagatactg
cttcactacaagacctgctcgcgatccgattgcattatctgcttacccttccgacagaat
cagcctccacaacaacagcagcaacaacaacaacagcagcagcagcagcaacagcagcag
caacaacaacaacagcagcagcagcagcagcaacaacaacaacaacaacaacaacagcag
cagcaacagctaccgcagggacaacaggtaccacaaaatgcatcgggcgtgggagttggc
gtcggtgttggggttggcgttggtgtcggcgtcgatggtaaacaggtggcgcagagcgct
ggcggaactggtggtccacaaaatacggccattgttctaccgcagcagcagacgcctggc
gcgcctaatgtgcccaagacaaacaccgatatggcacagcaactggcacagcaacaacag
cagcagcaacaacaacaacaccaacaagtggaactgcgtcgctttgagggcgttggcagt
atacttccagtgggaccggtagcatctggaatgctgggtgcgccgacgcaaggcatgcca
ccaggcatacgcatgcagggctctccagcggttcgtgtgcttggcgtgcagccaggacca
ggcggctcacttcctgggggactgccagtgccagtgtctgtgcccggacaaaatgttttg
cccggtgcgaacgatgtgaacagcttgcagcaacagcagcaggcgcaggcggcggcccag
cagggcggacaactgatgctgcagggttgcaacatagtcggtggacgcaggcgtgcgctt
cccaacatggttgaacagcagcagcagcagcaaccgaatgcgcaacagaatgctcagcag
cagcaacaattgggcaatataccagcaccgctatctgtcaatgttggcttcaacaattcc
aatttcgtcggagtcggcgtcaatgataagcaacagcagcagcaacaacaacagcagcag
cagcaacagttggtgggtcagtccgatcagctggccaagctgaagctgcaggctcaagcg
caagcacaagtgcaggcgcatggcggcaatgttgtgtcagcgggaggagtgccaggagct
ggagttgcagccggtgccagtgtgctgatgccggcggatacgacgggcggtggcaacagt
tcatcagttccaggcgttacgacaggcgctggagcaggtggtggtgctggcggtccggct
ggcagtggtggcgacaacgagaaagactggcgagaatcggtgacagctgatttgcgcaat
catttggtgcacaagctggtgcaagccatctttcccacatcagatccaaccacaatgcag
gacaagcgcatgcataatctcgtctcgtatgccgaaaaggtggagaaggacatgtacgag
atggccaaatcgagatccgagtactatcatctgcttgccgagaagatctacaagatacag
aaggaactcgaggagaaacgtctcaagcgcaaagagcagcaccaacagcaaatgttgcaa
atgcaacagcagggcgttcccaacagcggcgccgtcgtcaatcccacgtcggtagtgccg
aacaatacgcttcagcagcagcagcagcaacaacagcagcaacagcaacagcagcagcag
caacccggacaaggtgtgcgtcccatcatcagtcctatgggcggtggcggcgttgtacca
actggtatgatgccacagcagttgcgtcctcaggcgcctggcatgggtggcggtgttgtc
gccggccaacaacagacgccagccggtcaacccaacatggttgctgtggcggcgagcatg
cgcagtcattcgcctggcggtaatatgcttgcgatccagcaacagcagcgcatgcagttc
ccgcaacagcagcagcctggtcagggcaacatgttagttggaccgccagggcccagtccc
gggggcatggcagtgttgtccccattcaccggcttaacaagtccggtgcctgggcagcag
caacagcagcaacaacagcaacaacagcagcaacagcagcagcagcaacaacagcagcag
cagcaacaacagcaattcattaatgcgaatggtggcacgggtgcacaaaatccgcagctc
agcgaaattatgaagcagcgtctgctgcagcagcaccaacagcaaacagctgcagcaatg
ctattgcctcaatcgccctttagtaatgccacgcctattccacagcaacagcagcagcaa
caacaacaacagcagcagcaacagcagccccaacaacaacagcagcagcagcaacaacaa
caacaaacgaacgcatttagctcaccgatgcagcagcagaaggcacaacagccacctggt
agtgtgctgaataatatgccacccacgccgaccagcctcgatgcgctcaatgccggagca
gcgagtgctgctgctggtgccggtggtggtggcagtagtgggaatagtgggaatggtgga
tctggagctggagctggtactggtgctggtagtgctagtggtgttgtcagtagcggcact
gttgccgcaccaagtccctcacccagtttcatgtcgaatggaccgattgggacgccgtca
aacaatccgccctctgttagcagtctgatgcagccgttaagcaatcgtgcaacatcgccg
ccatatatacctgcctcgccagtgccggcaaccagcgcctcagggctggcgaccagcagt
acgcctgcctcgacagcggcaacatgcgccagcagcagtagcaacggtaatggcagcaac
agcagcagcgccgccagcagcagcagctgtacggcaattacaacgacagcgataacaacg
tcggttagcacaccgctcagcagtgcatcctcatcgacggcaacgccgacatcaacgaca
gcatcgagcggcaatggcggctcagtgccggctagcagcagcacgttgctattgatggga
cgcagtagtagcgagaatagcgctcctgtgcccaaccgaatgatgagcagctcgagcagt
ttatcgtctcagatggcggcactggaggcggcggcgcgtgataatgatgatgagacgcca
tcgccggcgggtgccaatgacacgaatggcagcaacggcggtagtggtggcggcggcatg
tcatctaagggcaaactggactccattaagcaggaggatgagatcaaaaaggatttcatg
gacgacagttgtggtggcaacggggatggctcgctgatggactgcttgacgggtggcaag
ggcaagaatgtgaacaatgatggcaccagcatggtgaaaattgaccttaagtcggaggat
ggtgccgacggcgacgtgaaaatcaaggctgagccaatggatgtggatgactcggcaacg
ggcagcggcattcctggtggcgccaatggcgatggcacgataggtggcagcggtatcgat
agcaaggatgatatcaagggtggcatcgatggcattgcctccggcggcgttggcgacatc
aaaatcaaatgtgagaccaagccaatagtgccagagccaatcgcaccaaatgccggcgat
aagaagaagaaatgccaattcaatccggaagagttgcgcacagcactgctgccaacgctg
gataaactatatcgccaggagccggaatcggtgccatttcgttatccagtcgatccacaa
gcgctgggcatacccgactactttgagattgttaaaaagccaatggatctgggcaccata
cggaacaacatcctgaatggcaaatacagtgatccctgggagtatgtagacgatgtgtgg
ctaatgtttgacgatgcgtggctttacaatcgcaaaacatcacgcgtatatcgttattgc
accaagttgtcggaggtcttcgaggctgaaatagatcccgtgatgcaagcgctgggatac
tgctgtggacgcaaatataccttcaatccgcaggtgctatgctgttatggcaaacaactg
tgcacgattccacgcgatgcaaaatactacagctatcaaaatagtttaaaggaatacggt
gttgcctcaaacagatacacgttctgccaaaagtgctttaatgacatccaaggagacact
gtcaccctgggcgatgatccggtgcagtcgcaaacccaaattaagaaggatcaattcaaa
gagatgaagaacgaccatttggaactggagccgtttgtcgattgccaggagtgtggtcgc
aaacagcaccagatctgcgtgctttggctggattcaatatggccgggcggctttgtgtgt
gataattgcttaaaaaagaagaactccaagcggaaggagaacaaattcaatgccaagcga
ttgcccaccaccaaactgggcgtgtacattgagacgcgcgtcaacaacttcttaaagaaa
aaggaggctggtgccggtgaggtacacatccgtgttgtatcctcatcagacaagtgcgtt
gaggttaagccgggcatgcggcgtcggtttgttgagggcggcgaaatgatgaatgagttt
ccatatcgggccaaggctctatttgcgtttgaggaggttgatggcattgatgtttgcttt
tttggcatgcatgtccaagaatatggttccgagtgtccagcgcccaatacgcgacgcgtc
tatattgcctatctcgattcagtgcatttctttcggccacgccaatatcgcacagccgtc
taccatgaaatactgctcggctatatggactatgtgaaacagctgggctacacgatggcg
catatttgggcgtgtccgccatctgaaggcgatgactatatatttcactgccatccgact
gatcagaaaataccgaagccgaagcgtttgcaggagtggtataaaaagatgcttgataag
ggcatgatcgagcgcatcatacaagactacaaggatatacttaagcaagccatggaggac
aaacttggctcggctgctgagttgccctactttgagggtgatttctggccgaatgtgctt
gaggagagcatcaaagaactggaccaggaagaagaggagaaacgtaagcaggccgaggcc
gccgaagcagcagcggctgccaatctcttttcaattgaggacaacgaagtcagtggcgat
ggcaaaaagaagggtcagaaaaaggcaaagaagtccaacaaatccaaagcggcgcagcgc
aaaaatagtaaaaagtcgaatgagcatcagtcgggcaatgatttgtccgccaagatctat
gccaccatggagaaacacaaggaggtcttctttgtcatccggcttcattcagcgcagtca
gcggcaagtctggcgcccatacaagatcctgaccctctgttgacctgcgatctaatggac
ggacgcgatgcattcctaacacttgcccgtgacaagcactacgaattctcatcgttgcga
cgcgcacagttctctacactgtcgatgctgtacgagctgcacaatcagggacaggataag
ttcgtatatacctgcaacaactgcaagactgcggtggagacacgatatcactgcaccgtt
tgcgatgattttgatctgtgcacggtatgcaaggagaaagtcggacacccacataaaatg
gaaaaactgggcttcgatctcgatgatggctcggcgccggctgatctcaagcaagcaaat
ccccaggaggcgcgaaaacaatccattcaacgatgcattcaatctctggtgcatgcgtgt
cagtgtcgcgacgccaattgccgtttgccttcgtgccagaagatgaagcgggttgtccag
catacaaagaactgcaagcgaaagacaaatggtggctgtcccatatgcaaacagttaatc
gccctctgctgctaccacgccaagcactgtcaggagcaaaagtgtccggtgcctttctgt
ccgaacatcaagcacaagcttaagcagcagcagctgcagcaaaaattacaacagcagcag
ctactgcgtcgccgtgttgcgctcatgtcgagaaccgcagcacccgctgctctacccgga
ccaacgatcagcgggcccgtggttgcagccggtggagtcggtgttggtgttcccgttgtg
ggcatgtccggtgtagcggtcagtcaacaggtgatgtctggccaggcttccatactgcca
gtcggtgccggtggcatgagtccatctactgtaacagtgccgtcgccggtttccgtcatg
ggcggaatgacgtctccgcatccacatcagcctggcattggcatgaagccgggcggtggc
cattcgccgtcgcccaatgtgctgcaggtagtcaagcaggtgcaggaggaggccgcacgc
caacaggtaccgcatgtgggtagctttggcaaaggtgtgccaatggcgccgcctgttatg
cagcgaccgatgggcgtgggcgtacccaaccagggcgccatgggcggcatggtcggcaat
gtgggtgtaaatcagctagctggaaatgtgggcgtcggtcccggagtcggacagctgccg
agcggggcgaactgcaacaatgtgttgaactccaataatctgctacccatggaacagtgg
ggcggtggtggtggcggtggtgttggtcctggacaacagcgctatgcgaacaatacaccc
aatcagtccggaatgcgtcagcccaaccaactgatgcagcagaacctacagcaacagcag
caacaacaacagatgatgggcatgccaccaaatcagatgggtggcggtgttggagtcggc
gttggcgttggcgctggtcagatgcccgtggtgggtggtggtgttaatatgggcggcggt
ggagcacctcatggtattggcatgggtgcgcccatgggtgctgcagccgctggcggtggt
gtacgcccaccaggcgctcagggcgtgggtactggcggtggcggtgctggcggtgcgggt
ccgaacatgggaagtggtccgccgctgaacacacagaccctggcacagatcatgcaaaag
attaagaacaatccgaccaatgagagcaaccagcacatactcagcatactgaaacagaat
ccacagattatggcggccatcattaagcagcgacagcagagccaaatcaatgctgccgcc
ggcggggctggtggtcccgttggtgcactgcaagcgggcaatggaccacagacgccgcaa
cagcagcagcaagtaatgcaacaacaacagcaaatgcagcacatgctgaatcagcagcaa
cagcaacagggccctggacccggaccacagcaaatgggacctggccaacagcagcaggtg
agcctaatgcaggcgcagcagcaacaacaaccgggaccaccgcatcaacgcatggccaac
atgcaaaatgcggcgatgatgctgccaaatctaccctccggcttaacctctcagggaggc
atggttcccaaccagaagtggaataacatgcgatacatgcaaatgaatcaatacccgcca
ccatatccacgccaacgaggcccacatatgagcggagctgggcaacagcaattcccgggt
ggcacagctggcaactttaatgcgggcggcgctggaactgttgccggtgttccagtagcc
ggcgcacccgttggtggcagcggttcggcgggtcccggctctgatcaatactcgatgacg
aatgcggcagcttccaatatgctgcaacagcagcagggcggcggtggtgctggggtaaag
cccgggccccaacaacagcaacagcagcagcaacaaatgggagtgatgccaccaggtatg
cagcagcaacaacccttgcaacagcagcagcaacaacagcagcaacaaatgatgcaggtt
gtggctgccggcggtggtggcatgaccaatgcaaatactcaaaatgcgatgcccggtggc
ggtggtggacccggtgggagcagtgcaaatgtgatgggcccaccaacaccgcatactctg
caacagcagctgatgcagtcggcccgctcctcaccaccgatacgttcgccacagccgacg
ccatcgccgcgatcagcgccatcaccacgggggccgtcagcatcgccgcgggcacagcct
tctccacaccatgttatgagtcattcaccggcgcctcagggaccacatgatggcatgcac
aatcatggcatgcatcatcaatcaccgctgccaggagtgccacaggatgtgggcgttagc
ggtgtcggtgtcggtgttaatgctggcaatgtgggtaatactggcggcgctttgcccgat
gcctccgatcagctaaccaagtttgtggagcggctctag

DBGET integrated database retrieval system