KEGG   Drosophila grimshawi: Dgri_GH13058Help
Entry
Dgri_GH13058      CDS       T01061                                 

Definition
GH13058 gene product from transcript GH13058-RA
Orthology
K10739  
replication factor A2
Organism
dgr  Drosophila grimshawi
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dgri_GH13058
   03420 Nucleotide excision repair
    Dgri_GH13058
   03430 Mismatch repair
    Dgri_GH13058
   03440 Homologous recombination
    Dgri_GH13058
   03460 Fanconi anemia pathway
    Dgri_GH13058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 240 aa AA seqDB search
MNDSFGDFNATQTATAGATKESSGEGIISLLVKQILDSPEGNFKMFDVAYALVCAVGIVR
NIETSSTKITYSIEDHSGRIDAHYWLEEGDAIKSPDVMLNNYVKIYGSVRSQAGQKVLMV
FKLLNVLDPNEVCTHVLEALHSRYKAEEYNHKGDGGPSNQLMPNVTASQSNAIVAGLDSK
QLAVFQAIKSNCSEEGIHRRELSAKFSHISQSEMTNILDFMISEGHIYSSIDPDHFICTM
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattcttttggtgatttcaatgccacacaaacggccacagccggcgccacaaag
gaatcctctggcgagggcattatttcattgctggtcaaacagattcttgattcgcccgag
ggcaatttcaagatgttcgatgtcgcctacgctttggtctgcgccgttggaattgtgcgc
aatattgagacgtcatcgacgaagattacttattctatagaggatcacagtggtcgcatc
gatgcacactactggctggaagagggcgatgccatcaagtcacccgatgttatgctcaat
aactatgtgaaaatctatggttccgtgcgttcgcaggcgggtcaaaaagttctgatggtc
ttcaagctgttaaatgtgctcgatcccaacgaggtgtgcacccacgtgctggaagcgctc
cattcgcgctacaaggctgaggagtacaatcacaaaggtgacggaggtccgagcaaccaa
ctgatgcccaatgtgacggccagtcaaagtaatgccattgtcgccggtctggacagcaag
cagctggctgtcttccaggccatcaagagcaactgctctgaggagggcattcatcggcgc
gaactgagcgcaaagttctcgcacatcagccagtccgagatgacaaatattttggacttt
atgatatccgaggggcatatttattccagtatcgatccggatcatttcatatgcaccatg
tag

DBGET integrated database retrieval system