KEGG   Drosophila grimshawi: Dgri_GH13082Help
Entry
Dgri_GH13082      CDS       T01061                                 

Definition
GH13082 gene product from transcript GH13082-RA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dgr  Drosophila grimshawi
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Dgri_GH13082
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Dgri_GH13082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 372 aa AA seqDB search
MKDNIDVLVFGSSNIDYITYVNELPKPGETVLAMHRERCFGGKGANQCVAASKLGANCAL
ITKLGTDALGEDYLEYLKTLEINLDFVERVESMPTGLAEIIVSDNAENTIIVLPGANSML
RPKDVSRCKKLFKNAKVLMCQLETEQKAVLFALQQFKGISILNASPMPKNINVELITTPT
ILCINEMEAAQLTEREQVNTLQDAKAAANEIIDKGAKSVIITMGALGAVFLSSTERDVCI
HCPAAPVRFLADTSGAGDAFLGSLAYHIAIFPNLHRESHISAANICAAYAVGHRGTQLSF
PGPEYAQNDLCRFVPTCTVIADESTKPTEPETTPAPTKTETLLPPVVEPEPKTTATTEAP
EQKDTEPQPISA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacaatattgacgtgctggtctttggttcatcaaatatcgactacattacatat
gtcaatgagttgcctaaaccgggagaaacagtactggcgatgcacagagagcgttgtttt
ggtggcaaaggcgccaatcaatgtgtggcagcttctaaactaggcgccaattgtgcgttg
ataacgaaattgggcaccgatgctctgggcgaagactacttggagtatttgaagacgtta
gagatcaatcttgactttgtggaaagggtggagagcatgcccaccggcttggccgaaatt
attgtgtccgacaatgcagagaacacaattatcgtgctgcccggtgcgaattcgatgctt
cggcccaaggatgtctctcgctgtaaaaaactgttcaagaacgccaaggttctgatgtgc
caactggagacggagcagaaggccgtactgtttgcactgcaacaatttaaggggatatcc
atattgaatgcgtctcccatgcccaagaacatcaacgtggaactgatcacaacacccaca
attctatgcatcaatgagatggaagctgctcagctaaccgaacgcgagcaggttaacacg
ttgcaggatgctaaagcagccgccaatgaaataatcgacaagggtgccaagagtgtcata
attacaatgggagcactgggcgcggtttttttgtcgagcacggaacgagatgtgtgcatc
cactgcccggccgcacctgtacgcttcctggccgacacttcgggtgctggtgatgccttt
ctcggcagcctagcctaccacatcgcgatctttcccaacctccaccgggagagtcatatc
agtgcggccaacatctgtgccgcgtacgctgttggccatcgcggcactcagcttagtttt
ccgggaccggaatatgctcagaatgatctatgtcgatttgtgcctacgtgcactgtgatc
gcggatgaatccaccaaacccactgagccagagacgacaccagctccaacaaaaacagaa
acactcctaccaccggtggtggagccagaacccaagacaactgccacaactgaagcccca
gagcaaaaggacaccgaaccacaaccaatatctgcataa

DBGET integrated database retrieval system