KEGG   Drosophila grimshawi: Dgri_GH13187Help
Entry
Dgri_GH13187      CDS       T01061                                 

Definition
GH13187 gene product from transcript GH13187-RA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dgr  Drosophila grimshawi
Module
cGMP signaling
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dgri_GH13187
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dgri_GH13187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 959 aa AA seqDB search
MKIKHYPGKAVDASLSLESDSAMGALYEANWLQAHHQHHSAPTATPTPIISTPAATTMAN
KLGRQPSNVGNINNNISHNNNNGSSSFLLNGISALSKYQMTLESIRQLESKDRRIVSAIK
ELNGYRPSALQHHQQQQLHNGWIAEDEQEQEQEQEHDQQQEPIKVNTHPQAEASVVNHYV
MDPTERQRVPRPRQQVSVKPPSLRRSQTMLQHQSRHPHQSQSQPPSTTHPHPSYVTLRHP
KLPAKLPQCNSNSSSAYSTFSSSAAEDQRPERVICQQPLRLLPPPIEPPPAPPVVATKQR
AFKPLSRSQTSVQRYATIRMPNHSASFCRAAERESRQTPALRRHSLEQALQGLQLEEEHQ
QQQQLVVRQPEQQQLQISPAGSSNGSSKDLNGEGFCIPRPRLIVPVHTYARRRRTGNLKE
QSSTAQDEELTSDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAISECNLWAI
ERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQG
ARGDTFFIISKGKVKVTIKQQDTQEEKFIRMLGKGDFFGEKALQGEDMRTANIICESPEG
VSCLVIDRETFNQLISSLDEIKHRYDDEGALERRKINEEFRDINLTDLRVIATLGVGGFG
RVELVQTNGDNSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKK
YLYMLMESCLGGELWTILRDKGNFDDATTRFYTACVVEAFDYLHSRNIIYRDLKPENLLL
DEKGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELL
TGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISE
IQKHKWFDGFYWWGLQNGSLEPPIKPSVKSVVDTTNFDDYPADPEGPPPDDVSGWDKDF
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaacattatccgggcaaagccgtcgacgcaagtctctcgctggagagcgac
agcgccatgggtgccctctacgaggccaactggctgcaggcgcatcatcagcatcacagt
gcacccactgccacgcccacaccgatcatatcaacgccagctgcgacgacgatggccaac
aaactcggccggcagccaagtaatgtgggcaacatcaacaacaacatcagccacaacaac
aacaatggcagcagcagttttctgctcaatggcatctcggctctgagcaagtatcagatg
acgctggagagcatcaggcagctggagtctaaggatcggcgtattgtgagcgccatcaag
gagctgaatggctatcgtccctcagcgctgcagcatcatcagcagcaacaactgcacaat
ggctggatagcagaggatgaacaggagcaggagcaggagcaggagcacgaccagcagcag
gagccaattaaagtaaatactcatccacaagcggaggccagtgttgtcaatcattatgtg
atggatccgacggaacgtcagcgtgtgccacgcccacgccaacaggtgtctgtcaagccg
ccctcgttgcgtcgctcacagaccatgctgcagcatcagtcgcgccacccacatcagtct
caatctcagcccccatcgacgactcatcctcatcccagttatgtgacgctgcgtcatccc
aagctgcccgccaaattgccacagtgcaacagcaacagttcctccgcctactccacattc
tcctcctccgccgccgaggatcaacggccggagcgggtcatctgccagcagccgttgcgt
ttgctgccaccacccatcgaaccaccaccggctcctccagtcgtggccacaaaacagcgt
gccttcaagccgctcagcagatcccagacgagcgttcagcgttatgccaccattcgaatg
cccaatcactccgcgtccttttgtcgtgcggccgagcgcgaatcgaggcaaacgccagcg
ttgaggcgccacagcctagagcaggcgctgcagggactacagctggaggaggagcaccag
cagcagcaacagttggtggtcaggcagccggagcaacagcaactacaaatctcgcctgcg
ggcagcagcaatggcagctccaaggatctcaatggcgagggcttctgcataccccggcca
cgcctcattgtgcccgtgcacacatatgcgcgacgacgtcgcaccggcaatctcaaggag
caatcctcaacggcacaggacgaggagctcaccagtgatggacgcgtcgaggtctcacgc
gagggtaaatatctatccacactctctggcgccaaggtactgggcgaattggcaatactg
tacaactgccagaggacggcgacaatcacagcgatcagcgagtgcaatctgtgggcgatt
gagcgtcaatgcttccagacgatcatgatgcgcaccggcctcatccgacaggcggagtac
acggatttcctcaagagcgttcccattttcaaagacttggccgaggatactctaatcaaa
atctccgatgtcctggaggagacgcactatcagcgcggtgattacattgtgcggcaggga
gcacgaggcgacaccttcttcatcatatcgaagggcaaggtgaaggtgacgatcaagcag
caggatacgcaggaggagaagttcatacgaatgcttggcaagggtgatttctttggcgag
aaagccctccaaggtgaggatatgcgcacagccaacattatttgtgaatcccctgagggt
gtcagctgtttggtcattgatcgcgagacattcaatcagctgatctcgagtctggatgag
atcaagcatcgctacgacgacgaaggtgccttggagcgcagaaaaatcaatgaggagttc
cgcgacattaatctgacagatttgcgtgtgattgccacattgggtgtgggtggctttgga
cgcgttgagctggtgcaaacgaatggcgataattcgcgctcctttgccctcaagcagatg
aagaagtcacagattgtggagacgcgccagcagcagcacatcatgtcagagaaggagatc
atgggcgaggccaattgccagtttatagtcaagctgttcaagacgttcaaggacaagaaa
tacctgtacatgctgatggagagctgcctgggcggagagctctggaccatattgcgggac
aagggcaactttgatgatgccacaacgagattctacacggcctgcgtagtggaggcattc
gactatctgcactcgcgcaacattatctacagggatctgaagccggagaatctgctgctg
gacgagaagggctatgtgaagcttgtagactttggttttgccaagaaactgcaaacgggc
cgcaaaacgtggacattctgtggcacgcccgaatatgtggcacccgaggtgatattgaat
cgtggccatgacattagcgccgactactggtcgctcggtgtgctcatgtttgagctccta
acgggtactccaccgtttacgggttcggatccgatgcgcacctataacataatacttaag
ggcatcgatgccatcgaatttccgcgcaacattacgcgcaacgccagcaatctgatcaag
aaactctgtcgcgataatcccgccgagcgtttgggctatcagcgaggcggtattagcgag
atacagaaacacaagtggtttgacggcttctactggtggggtctgcagaatggttcgctg
gagccgccgattaagccgagcgtaaagagcgttgtcgatacgaccaatttcgatgactat
ccggccgatccggaaggaccgccacccgatgatgtcagcggctgggataaggatttctaa

DBGET integrated database retrieval system