KEGG   Drosophila grimshawi: Dgri_GH13234Help
Entry
Dgri_GH13234      CDS       T01061                                 

Definition
GH13234 gene product from transcript GH13234-RA
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dgri_GH13234
Protein kinases [BR:dgr01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dgri_GH13234
Spliceosome [BR:dgr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dgri_GH13234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2060 aa AA seqDB search
MSDELSELIALSCPDLTARPEGTLDIQRRLSIKQMTATELTNLRAAAAAEAEAEAQARIQ
AEAKARALAEARARVTAEIEAAKARALAEQQARVAAEVVARACELAEYEAQEQLQRIAEQ
QRNLQEEQQRKKEVTRDPPISLPNILDDAMEMHLLNASECNPSVSGQCTSPPKTKTKAQL
ADSIELLRMQRAARDARSQHCSRERSISPAARHHERSAAPERLRSSSISSIDSARASGSG
SVSVSVSRRGSTASAMSSDPAADLTALPKFPLSKTVSAPVINTRRSSLTALFPGPSPLVA
PEPTLHTNPDMAPVADTPRPGSHEDGYRDIPSGKMLHRTKTPPPVGASLGVCLKRVAAPS
GSITIKPKEPNMLGVVLRRVEKKTVPYKSILDDDKPLYHLSIVRSDHKEYKPAPKPIPKP
APPVVKPSPGGILTGPQVGRTVNRPVVLPAKPQRPQIGVPITITKIEGDKIIIIKKIIVP
KNSKIPEQYLQVGCLYGVRCTVSLVSGESVVQFFVYTAAMRPSEESFASSSSPNIMQKPT
PPPASGQQSFFHVVSPQFASVFSSSLPETKCAVRSPISSPLALRKNRPLLPASPKSTPPL
PRKHHPMAYNAATGAITTPSRTMATIASSPASSISLSSCSTPSSSPPPPVPCRAPKQKPN
SNAKIPGEINLDKLLQQQQQLEEKSAAATSSAKQDANFYDAEIEMMNKYLKSLPDYSELD
RKLHQEFQECEDLYDRLKRQQQQQPLTKSNSHQSMPLKTSHPALSSAASTGLSKSSSINF
ANNLTSNRAPRLAYPSIFAQPSGSELPKLQRSISSSNMPMGTPNSGPLRPLDHQKDNLMS
DSNLSLNKQLMNDFWSENLCSSQKRQTPKRTFWNYEKICGAQLGDAGQPFKVDAKTAKKL
AIFDPTVAEAAQKELQKQLPQAAQQSLPSSHRLQKNASLSHLDLKVRQAVTKDDLYKLIV
CNEQSPTSPFSSRVPVKQPQQPQQHQQLQQQQQQPVAANATQLLNKSVSMTHVPGGGSQA
ATPLLRSSSRTHIPCYMKHLPSLTRSTSNSAILLPTTTPTTATAPTATQPPARKEPLPLK
QQPSAVNSKPNAGVLKSSSSSCVPSPRCAAALFRRPTETTGKQTVTAATKAQVPPPPQAE
SSKECASLERKSEKSNSTVSSSSFTVTNCCTTHLPQLSKFTSSFHIPSTVATTATAASQQ
QQQPIANSDQPTTTASTTTTAASSSSAIASATTASSSSTSSAATKRQKDVDNKQEKCLND
MLKLKSNNNSGIMSQSLTVEHKEDVAAASSSGGVKFTTESQIPVPVQLYDPQKPLLQQQQ
QRMAYPIGKSNSTSQLPMGYQRLLQQQQQQQQQQQQQQQHHQRHQQQQHQQQQQQQQHYP
QQKRPFLNWNSFACSAMNGSIDPFQQHPHKLQQSYSSSHVAKQAPKSSNGLAMFMQKNTN
KENKFGQPLHQQQQQQQLPAGMAPQMYGNSYQAMINTKPTYQRVGGGGAPLTHSASFSSA
QRPSIMQPQQHNFGLGMMSRNYYNLPKQQQQQQPQQHMQQQPAPHERKPLQTFDPYAYLK
PSQSQVVHPVKYQAQTQPHPHTQFHNASGAGGPALQYDPNTNTQLFYGPLPPSSSTGMQP
QAAQQQQQQQQQQQSLQQSNSVIFSHSKQHLHQQQQQQQQQQQQQQNEMSKSALGLHFIE
TAKPVIQDDADGHLIYHNGDILHHRYKIMATLGEGTFGRVVKVKDMERDFCMALKIIKNV
EKYREAAKLEINALEKIAQKDPHGDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENN
YEPYSLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSEYTSHYNHKINREVRRV
KSTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGI
TLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFYHGKLDWDEKSSAGRYVRD
HCMPLVLSQLSDTEDHCELFSLIKKMLEYEPSSRITLGEALRHPFFDRLPPHQRVGEMGV
SKQPLSSGSSSRERSHSLSR
NT seq 6183 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgaactaagcgaactgatcgcactcagctgcccggatctcactgctcgaccc
gagggcactctcgatatccagcgtcgcctcagcatcaaacaaatgacagccacggagcta
accaatctgcgtgctgcagcagctgccgaggctgaggccgaggcgcaggctcgaatccaa
gccgaggccaaggcgcgtgctctggccgaggcgcgggcccgagtgaccgccgagattgag
gccgccaaggcgcgtgctctggccgagcagcaggctcgcgtggccgccgaagttgtggcc
agagcatgcgaacttgccgaatacgaagcccaggagcagctgcagcgcatcgcggagcaa
cagcgtaatttgcaggaggagcaacaaagaaaaaaagaggtaacgcgtgatcctcccatt
tcgctgcccaacattctggacgatgccatggaaatgcatttgctaaacgctagcgaatgc
aatccctccgtctctggccaatgcacgtcgccccccaaaaccaagaccaaagcgcaactg
gccgactccattgagttgctgcgcatgcagcgggcagctcgagacgcccggtcccagcat
tgcagtcgggagcgcagcatatcgccagcggcgcgacatcatgagagaagcgctgcacct
gaacgcctgcgcagctccagcattagcagcattgattctgcccgtgccagtggaagtgga
agtgtcagcgttagcgttagtcgtcgtggcagcaccgccagcgccatgagcagtgatccc
gcagcggatctgacagcactacccaagtttccgctgtcgaagacggtgtccgctccggtc
ataaacactcgtcgcagcagtctaacagcactatttccgggtccatcgccgcttgtggct
ccggagccaacgctgcacaccaatccagatatggcgccagtagcggacacaccaaggccg
ggcagtcacgaggatggatatcgtgatatacccagtggtaaaatgctgcatcgcacaaag
accccaccgccagttggtgccagtttgggcgtgtgcctcaaacgggtcgcggcgcccagc
ggctcgatcaccatcaagcccaaggagccgaatatgctgggcgtggtgttgcgccgggtc
gaaaagaagacagtgccatacaagagcattctggatgatgacaaaccattatatcatctg
tccattgtgcgcagcgatcacaaggaatacaagccagcgccaaagccgataccgaagccc
gcaccgccggtggttaagccgtcgccgggcggcatcctaactgggccgcaggtggggcgt
accgtcaaccgtccggttgtgttgcctgctaagccgcaacggccacaaataggtgtgccc
ataaccattacgaaaatcgagggtgataagataattataatcaaaaagattattgtgccg
aagaacagtaagataccggaacagtatctgcaggttggttgtctgtatggtgtacggtgt
acggtgtctctggtgtctggtgaatctgttgtccagttcttcgtttacaccgccgcaatg
agaccaagtgaagaatcattcgcgtcgtcatcgtcgccaaatattatgcagaaaccaacg
ccgccgcccgcgagcggacagcagtctttctttcatgtcgtttcgccgcagttcgcgtcc
gtattctcctctagtttgccggaaacgaagtgcgcggttcgttcgcccatctcgtcgccg
ttggcattgcggaagaatcggccgctgttgccggcaagtcccaagtcgacaccgccgctg
ccacgcaaacatcatccgatggcgtacaatgcggccacaggcgccatcacaacgccatcg
cgtacaatggccaccattgcgagcagtcccgcctcgagtatatcgctgtcgtcctgcagt
acgccatcctcgtcaccgccgccgccagtgccatgtcgcgcacccaagcagaagccaaac
tccaacgctaagattcccggtgagatcaatctggataagctgctgcagcagcagcaacaa
ttggaggagaaatcggcagcggccaccagcagtgctaagcaggatgctaatttctatgat
gctgagatcgagatgatgaataagtatttgaagagtttgcccgactatagtgaattagat
cgcaaactgcatcaggagttccaggaatgcgaggatctctatgatcggcttaagcgtcag
cagcagcagcagccattaaccaaatccaattcgcatcaatcaatgccgctgaagacgtcg
catcccgccctgtcgagcgctgccagcactggcctctccaaatcgtcgtccatcaatttt
gccaacaatctgacatcgaatcgagcacctcgcctcgcctatccctcaatatttgcccag
ccgagcggcagtgagctacccaagctgcagcgcagcatatctagctccaatatgccaatg
ggcacgcccaattccggtccgctgcgtccactggaccaccagaaggataacctgatgagc
gactcgaatttgtcgctcaacaaacagcttatgaacgatttctggagcgagaatctctgc
agctcgcagaagcgccagacgccaaagcgcaccttctggaactatgagaagatctgcggt
gcacagctgggcgatgctggacagcccttcaaggtggacgcgaagacggccaaaaagctg
gccatctttgatcccactgtagccgaggcggcacagaaagagttgcagaaacagctgccg
caggcggcacagcaatcgctgccgtcgagccatcgcctacagaagaacgcctcgttgtcg
catttggatctcaaggtcagacaggccgtgaccaaggatgatctgtacaagctcatcgta
tgcaacgaacaatcgcccacgtcgccattcagcagtcgagtgcccgtcaagcaaccacag
cagccacaacagcaccagcaactacagcaacaacaacaacagccagtggcagcaaatgcc
actcagttgctcaacaaaagcgtctccatgacgcatgtgcctggaggtggcagtcaggcg
gcaacgccgcttttgcgcagttccagtcgcacacacataccctgctacatgaaacatctg
ccatcgctaacgcgcagcacatccaactcggctatattgctgcccacaacaacaccgaca
acggcaacagcaccaacagcaacgcagccgccagcccgcaaggagccactgccactaaag
caacagccgtccgctgtaaacagtaaaccaaatgcaggtgtacttaaaagctccagcagt
tcctgtgtaccatcgccgcgatgcgctgccgcactctttcgccgacccacagaaacgaca
ggcaaacaaacagtcactgcagctacaaaagcacaagttcctcctccacctcaggccgaa
tcgtccaaggagtgtgcctctttggaacgtaagtcggagaagagcaacagcactgtgagc
agcagtagcttcactgtaaccaattgctgtaccacgcatttgccgcagctgtccaagttt
acttcatcctttcacataccctcaacagtagcgacaactgcaacagcagcgtcgcagcag
caacagcaaccaattgccaactcggatcagccaactacaactgcatcaacaacgacaaca
gcagcatcatcatcatcagcaatagcatcagcaacaacggcatcatcctcatcaacgtca
tcagcagcgacgaagcgtcaaaaagatgtcgacaacaagcaagaaaaatgtctgaatgac
atgctaaagctaaagagcaacaacaacagtggaattatgtcacagtcgctgacagttgag
cacaaagaagacgttgcagcagctagcagtagcggtggcgttaaatttacaaccgaatcg
caaatacccgtgccagtgcagctctacgatccgcagaagccgctgttgcagcagcagcag
cagaggatggcatatccaattggcaagtccaattctacctctcagctgcccatgggctat
cagcgactgctgcaacagcagcaacaacaacagcaacaacaacagcaacaacagcagcac
catcaacgacatcaacaacagcaacatcagcagcagcaacaacaacaacaacattatcct
cagcaaaagcgaccatttttaaattggaactcgtttgcctgctcggctatgaatggcagc
atcgatcccttccagcaacatccgcacaagctgcagcaatcctattcctcttcgcatgtg
gccaagcaggcgccgaaatccagcaacggcctggccatgttcatgcaaaagaacaccaac
aaggaaaacaaatttggccaaccactgcatcaacagcagcagcagcagcagttgccagct
ggcatggcacctcagatgtatggcaacagttatcaggctatgattaatacaaagccaact
tatcaacgcgtcggtggtggtggtgcaccgctgacccactcggcatcctttagctccgca
cagcggccaagtataatgcaaccgcagcagcataactttggtctgggcatgatgagtcgc
aactattacaatctgcccaagcaacagcagcagcaacaaccacagcaacatatgcagcag
caaccggcaccgcatgagcgtaagccactgcagaccttcgatccatatgcatacctcaag
cccagccagagtcaggtggtgcacccggtcaagtaccaagcccagacgcaaccacatccg
catacgcagtttcacaacgcttccggcgctggtggtcccgcgcttcaatacgatccaaat
acaaatacgcaattgttttatggaccactgccgccttcatcgtcaacgggcatgcaacca
caggcagcgcaacagcagcaacagcaacaacaacagcaacagtcactacaacaaagcaat
tctgtcatattcagccactcaaaacaacacttacaccagcaacagcaacaacaacaacag
cagcagcaacaacaacaaaatgaaatgtccaagtccgctttgggcctgcatttcatcgag
acagcaaagcccgtcattcaagatgatgctgatggtcacttaatttaccacaacggagac
attctccaccacagatataaaatcatggccacattgggcgagggcaccttcggacgtgtg
gtcaaggtcaaagacatggagcgtgatttttgcatggccttgaagatcatcaagaatgtt
gagaaatatcgcgaggctgcaaagctggagatcaatgctttagagaagatagcacaaaag
gatccgcatggtgatcacctgtgcgtcaaaatgattgactggtttgattatcatggacac
atgtgcatagtttttgaaatgcttggacttagtgttttcgattttttgcgcgagaacaac
tatgagccgtattccttggaccaagtgcgtcacatggcctatcaattatgctattctgtg
aagtttctacatgacaatcgattaacgcacacagatctcaagccggagaatatactgttt
gtcgattcggaatacacgtctcactataatcataaaattaatcgtgaagtgcgccgcgtc
aaaagtacagatgtgcgcctaattgactttggctcggccacctttgatcatgaacaccat
agcacaattgtctcgacgcgccattatcgcgcgccggaggtcatactggagctaggctgg
tcacagccctgtgatgtttggtccatcggttgcatcttgttcgagctgtatttgggcatc
acactatttcagacgcacgacaatcgcgagcatctggccatgatggagcgcatcttggga
caaattccatatcgcatggcacgcaatcacactctttacagcaaaaccaaaacaaagtac
ttctatcatggtaagttagattgggatgagaagtccagcgcgggtcgttatgtgcgcgat
cattgcatgccgttggtactcagtcaactgagcgacaccgaggatcactgtgagctgttc
agcttgatcaagaagatgttggagtacgagccctcgtcgcgcatcacgttaggtgaagcc
ttaagacatccgttctttgatagactgccaccacaccagcgtgttggtgaaatgggtgtg
agcaagcagcctctctcgtccggcagcagcagccgcgagcgatcccatagtctgtccaga
tga

DBGET integrated database retrieval system