KEGG   Drosophila grimshawi: Dgri_GH13236Help
Entry
Dgri_GH13236      CDS       T01061                                 

Definition
GH13236 gene product from transcript GH13236-RA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
dgr  Drosophila grimshawi
Brite
Ribosome [BR:dgr03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Dgri_GH13236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 205 aa AA seqDB search
MLPLARAFYSSVARISRNNRVALHTASTLRCKEATVVDNEAPAENSEESGSDASPPDGKD
RTKVIPVETSMRYLKSAAYRTTYGEEFVWTQYRRNHKGMYAPRKTRKTCVRQGKISTGNP
CPICRDEYLVLDYRNTDLLKQFISPYSGQVLSYSKTGLCQKSHLRLKVAVEQARDCGLLT
YDVPFREYDYSEYYGKQEEPIQLKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgttacctttagcacgcgcattttattcgagcgtggcacgcatttcgcgcaacaatcgt
gttgcgctgcacacggccagcacgcttcggtgcaaagaggcaacggtcgtagacaatgaa
gcaccggcagagaacagcgaagaaagcggctcagatgcttctccaccagatggaaaggat
cgcacgaaagtgattcccgtggagacttccatgcgctatctcaagagtgccgcgtaccga
acaacctatggcgaggagttcgtgtggacacaatatcgtcgaaaccacaagggaatgtat
gcgccgcgcaagacgcgtaaaacgtgcgttcgccagggcaaaatctccacagggaatccg
tgtcctatttgtcgggatgagtatctggtgctggattaccgcaacacagatctgctgaaa
cagttcatctcgccatatagcggtcaggtgctgagctactccaaaaccgggttatgccaa
aaaagtcatttacgtttaaaggttgccgtggagcaggctcgtgattgcggcctcctcacc
tacgatgtgccttttcgggaatacgactacagcgagtactatggtaagcaggaggagcca
atacaattaaaatcataa

DBGET integrated database retrieval system