KEGG   Drosophila grimshawi: Dgri_GH13301Help
Entry
Dgri_GH13301      CDS       T01061                                 

Definition
GH13301 gene product from transcript GH13301-RA
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Dgri_GH13301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 340 aa AA seqDB search
MSCNYAEGLSAYENKGVLGVPENFDSEEIVNQKCKELANLIKESKHVVIHTGAGISTSAG
IPDFRGPKGVWTLEQKGEKPTFNISFDEAQPTKSHMALRALVDHGYVHYIVSQNIDGLHL
KSGLDRKYLAELHGNIFIEQCQKCRRQFVRQTAVEKVGQKLLDLPCRSIDMDNSRSCRGG
VMHDNVLDWEHDLPERDLDMAFMHSTLADLNITLGTTLQIVPSGNLPLKNLKHGGKLVIC
NLQPTKHDKKAFLGISSYIDDILTKVCKRLGIEIPDYSDESDPTKHSNIAEWTLPQEYVK
ALDKLFKEHQKITAKKRENSSLKCKHLIDEKSIKKRKCSE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtaattatgcggaagggctgtcagcatacgaaaataagggcgtcttaggtgta
ccagaaaactttgacagcgaagaaattgtcaaccaaaaatgcaaagagttggcaaattta
ataaaagagtcgaaacatgttgtaatccacacaggagcaggcattagtacatcggctggt
ataccagattttaggggtcctaaaggagtctggacgcttgagcaaaaaggtgaaaagcct
acttttaacatatcttttgacgaagcacagccaacaaaatctcacatggcactgcgggct
ttagtcgaccacggatatgttcattatatcgtctcgcaaaacattgatggacttcattta
aaatcgggacttgatcgcaaatatttagcggagcttcatggcaatatttttattgagcaa
tgccaaaaatgtcgtcgacaatttgttcgccaaactgctgtggaaaaggtgggtcaaaaa
ctattggatcttccatgtagatccattgatatggacaatagtcgaagttgccgtggtgga
gttatgcacgacaatgtcctggattgggaacacgatctgccggaacgggatctagatatg
gcatttatgcattccacattagctgatcttaatattacactgggcaccacgctacaaatc
gttccaagcggcaatttgccacttaaaaatctcaaacatggcggtaaacttgtcatttgc
aacctgcaaccaacaaaacatgacaagaaagcatttttaggcatatctagttatattgac
gatatattaacaaaagtatgcaaacgtctgggcatagaaattccagattattccgatgaa
tcggatcccacaaagcattccaacattgcagaatggactctgccacaagaatatgtaaaa
gctttggacaaactattcaaagaacaccagaaaattacagccaagaaacgcgaaaacagt
tctttaaaatgtaaacacttaattgacgaaaaatcaattaaaaagcgaaaatgcagtgaa
taa

DBGET integrated database retrieval system