KEGG   Drosophila grimshawi: Dgri_GH13317Help
Entry
Dgri_GH13317      CDS       T01061                                 

Definition
GH13317 gene product from transcript GH13317-RA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
dgr  Drosophila grimshawi
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dgr00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 913 aa AA seqDB search
MATNLRIAVIGQSNFAADVLEQLLENSSVKVVGVFTIPDKGSREDILATTAASHNIPVFK
FASWRRKGVALPEVLEQYKSVGATLNLLPYCSQFIPMEVIDGAALGSICYHPSILPRHRG
ASAISWTLIEGDEIAGFSIFWADDGLDTGPLLLTRQTNLEPTDTLDSIYKRFLYPEGVKA
MVLAVDMVAKGTAPKIVQTEVGATYDPAMFRAENQILNLQQSAERIWNFIRGLDSVPGAI
ATVLQADGSEEQVRLFGAHLYSAGPVRAAQEIKLKGLPKPAWVHENGLLIEGTDGQLVNV
RRIKRGSKMINACDWFKLAEHHPITDFTEDELVKRTDLSAIWQAILKQSIEASTDFFAAG
AGSMDVVRLVEEVKEAFDVPLENEQVFMAPVFEEFFDLLIRTLRQGSSGGSSSKISYEGF
TLKANKREIRVPTQLFINGVFLDAEKQRTLDIINPTNEQLLCKVACASVADADKAVQAAH
KAFYGSWKQVSARQRGLLMLRLADLMEQHKEELATIESVDSGAVYTLALKTHIGMSIDAW
RYFAGWCDKIQGNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAA
GNTCLIKPAQTCPLTALKFAELSVLAGFPPGVINVLPGKGSEAGQAVADHGLVNKLGFTG
STPVGQHIMKSCAASNLKKCSLELGGKSPLVIFADCDLDKAVRHGMSSVFFNKGENCIAA
GRLFVEDRIHDEFVRRVLKDLRTMTIGDPLNRSTAHGPQNHKAHFDKLIEFCETGVAEGA
KLVYGGCRVPNMKGYFFMPTVFTDVADDMFIAKEESFGPIMIISKFNGSDVDSVMLRANR
TDYGLASGVFTKDISKALNFADRIDAGTVFVNVYNKTDVAAPFGGFKQSGFGKDLGQEAL
NEYMKTKCVTIEY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaatctgcgcattgcggttattggccagagcaactttgccgccgatgtattg
gagcagctcttggagaattcaagcgttaaagtcgttggagtctttacgatacccgataaa
ggaagtcgcgaggatattttggctaccaccgctgccagccataatatacccgttttcaaa
ttcgccagctggcgacgcaaaggcgtggccctgcccgaggtcctggagcagtacaaatcg
gtgggagcgaccctcaatttgctgccgtattgctcccagttcatacccatggaggtgatt
gatggggctgcactgggcagcatttgctatcatccctccatattgcccagacatcgcgga
gccagcgccatttcctggacactcattgagggcgatgagatcgctggcttcagcatcttt
tgggcagatgatggtttggacactggaccactgctgctgacgcgccagacaaatttggag
ccaacagacactttggacagcatttacaagcgattcctatacccggagggtgttaaggca
atggtcctggccgtggacatggtcgccaagggcacggcaccaaagatcgtgcaaactgag
gtgggcgccacctatgatcccgccatgtttcgggcagagaaccagatactgaatttacaa
cagtcagcggaacgtatatggaattttattagaggcttggattcagtgccgggtgccata
gcgacggtccttcaagccgatggcagtgaagagcaggtgcgtctctttggcgcccatctc
tactcagcgggacccgtacgagccgcacaagagattaagttgaagggtctgccgaagccc
gcctgggtgcatgagaatggactcttgattgagggcaccgatggccaacttgtcaacgtg
cgtcgcattaagcgtggctccaagatgatcaatgcatgcgattggttcaaactggccgaa
catcatcccattacggacttcaccgaggatgagttggtgaagcgaacggatctgtctgcc
atttggcaggcgatattgaagcaatcaattgaagcatcaacggatttctttgctgccggc
gccggttccatggatgtggtgcgtctcgttgaggaggtcaaggaggcattcgatgtgccc
ctcgaaaacgagcaggtgttcatggcgcccgttttcgaagagttctttgatctattgatt
cgtacactgcgacagggcagctccggcggcagctccagcaagattagctatgaaggattc
acgttgaaggcgaataaacgtgagattcgagtgccaacccagctgttcatcaatggtgtg
tttctggatgccgaaaagcagcgcaccctggacattatcaatccgaccaatgaacagttg
ctctgcaaagtggcatgtgcgagtgtggcagatgcggacaaagctgtccaggcggcgcac
aaagcattctacggctcctggaagcaggtgtcggccaggcaacggggtctactcatgctc
cggctggccgatctgatggaacagcacaaggaggagctggcgaccattgagtctgtggat
tccggtgcggtttacacgctggctctgaagacacacattggcatgtccatcgatgcgtgg
cgttattttgctggttggtgtgataagatccagggcaacacgatacccgtgaatcctgct
cggcccaacaatgtgctgacctttacgcgcaaggagccaattggtgtctgtggccttatc
acgccctggaactatccactgatgatgctctcctggaagatggccgcttgtattgccgcc
ggcaatacctgcctgatcaaaccggctcagacctgtccattgacagcgctcaaattcgca
gagctcagcgtactcgctggcttcccgcctggtgtgattaatgtgctgcccggcaaggga
tcggaagcgggtcaggcggttgccgatcatggtttagttaacaaactgggcttcaccggt
tcgacgcccgttggtcaacacattatgaagtcctgcgccgcatccaatctcaagaaatgt
tcactggaactgggcggcaagagtcctttggttatattcgctgactgcgatttggataag
gctgtcagacatggcatgtcatcggtatttttcaataagggtgaaaattgcatagccgct
ggacgtttgttcgtcgaggatcgcattcacgatgagtttgtgcgtcgcgtgctgaaggat
ttgcgcaccatgacgattggggatccgctcaatcggtccaccgcacatggaccgcagaat
cacaaggctcactttgacaagctgatcgagttctgcgaaacgggcgtggcagagggcgcc
aagcttgtctacggaggctgtcgtgtgcccaatatgaagggttatttcttcatgccaaca
gtgttcacggatgttgcggatgatatgtttatcgccaaggaggaatcctttggtcccatc
atgatcatatccaagtttaatggcagcgatgtcgattccgttatgctgcgtgccaatcgc
acggattatggactcgccagtggtgtcttcaccaaggacattagcaaggctctcaatttc
gccgatcgcatcgatgctggcaccgtttttgtaaatgtctacaacaaaaccgatgtcgct
gctccatttggtggcttcaagcagagcggctttggcaaggatttgggccaggaagcgctc
aacgagtatatgaagaccaagtgtgtcaccattgaatattga

DBGET integrated database retrieval system