KEGG   Drosophila grimshawi: Dgri_GH13356Help
Entry
Dgri_GH13356      CDS       T01061                                 

Definition
GH13356 gene product from transcript GH13356-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dgri_GH13356
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C67
   Dgri_GH13356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 618 aa AA seqDB search
MNIKDRDIIVINKSDIEESTKNEHNVIIVNNPQEKENVDLADLLGSNWPTNAGGAAMILN
RPKTTDNNLEKSVTSSGNFVRNKEDFAQKVISPVDVKSIANPEINSSNYQELHEIPGTKL
TIGSLVEVSDSGICADLYGVIRWIGIAPDLPHILVGIEVEDDPNLKNLTTSDGTYNGVRL
FQCREGGAIFVPPNKCTNDRRFVETEGNHSVSVISTDTNAVKFGHVDCPPVLGAVAPLGI
HNIDELENICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPDAQDISHYSAVQN
VLRDEIVNPLRKNVFVRADRVMKLRKFLDQLSSVSGLTSEEKDPEEFLNSLLSQIMRVEP
FLKLSSGQDSYFYQLFVEKDERLTFPTVQQLFEQSFHSSDIKLKEVPSCLIIQMPRFGKS
YKMYSRILPSQVLDITDIIEDSPRQCSVCGKLAEYECRECFGSLQAGSGLEGTAFCQKCL
NTAHMHAKRANHESKKLSVPRDFKVMADHMTLPRLYMELFAVVCIETSHYVAFVKAGSGP
DAPWCFFDSMADRKGEKNGYNIPEMISVRELPQWLSDEGARVINERSIKDKVLPEHAKRL
FCDAYMCMYQSTDVMMYH
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaaggatcgggacattatcgtcatcaacaaatcggacattgaggagtccacc
aagaacgaacataatgtcatcattgttaacaatcctcaagaaaaggagaatgttgactta
gccgatttgcttggttcgaattggccaacaaatgctggaggagcagcaatgattttaaac
cgaccaaaaactacggacaataatttagaaaaatcggtaacatcgtctggtaattttgta
aggaataaggaagactttgcccaaaaagttatttcaccggtggatgtcaaatctattgca
aatcctgagataaacagttcaaattaccaggagttacatgaaatacctggaactaaacta
acgatcggatctctcgttgaggtatcggattctggaatttgtgccgatctatatggcgta
atacgttggatcggcatagcgccggacttgccacacatattagttggcatcgaagtggaa
gatgatccaaacttaaagaatcttaccacatcggatggaacttataatggcgtccgattg
tttcagtgtcgtgaaggtggagctattttcgtgcctcccaataaatgcacaaatgatcga
aggtttgtcgaaaccgagggaaatcattcagtaagcgttatttcaactgacacgaatgca
gttaaatttggacatgttgattgccctccagttttgggcgctgttgcaccattaggcata
cacaacatcgatgaactggaaaatatttgcggtaaatttaaaggcatccagggacaccac
aattcatgttatttggacgcaacattgttttccatgtttacgttcacgagcgtatttgat
tccattttatatagaagaccagatgctcaggacatttcacactatagtgctgttcagaac
gttttacgagatgagattgttaatccattgcgaaagaatgtttttgttcgtgcggatcgg
gtaatgaaactacgcaaatttctggatcagcttagttctgtgagcggcttgaccagtgag
gaaaaggatccagaagagttcttaaacagtttgctgtctcaaataatgcgagtggaacca
tttttaaaattaagctctggacaagattcatatttttatcaattgtttgtggagaaagac
gaacgacttacatttccgacggtccagcagctatttgagcaaagtttccattcgtccgac
atcaaattgaaagaagtgccgtcatgtcttattatacaaatgcctcgctttggcaagagc
tacaaaatgtattcccgaattttaccatcccaagtgctggatattacagatataattgaa
gactcaccgcgacagtgttcggtttgtggcaaactggctgaatatgaatgtcgtgaatgt
tttggttccttgcaggcaggctctggacttgagggcacagccttttgtcaaaaatgcctt
aatacggcccatatgcatgctaaaagagctaatcatgagtcgaagaaactgtctgtgcca
agggatttcaaagtgatggctgatcacatgactttgcccagactgtatatggaattattt
gccgttgtgtgtatagaaacatcgcattatgtggcattcgtaaaggcaggatcaggacca
gatgctccatggtgtttctttgactcaatggcagatagaaaaggtgaaaagaatggatat
aatatacctgaaatgatatccgttcgggaattgcctcaatggctatcagatgagggcgct
cgagtaatcaatgaaagatcaataaaggataaagttttacctgaacacgcaaagcgtctg
ttttgcgatgcctatatgtgcatgtaccaaagcaccgatgttatgatgtatcactaa

DBGET integrated database retrieval system