KEGG   Drosophila grimshawi: Dgri_GH13443Help
Entry
Dgri_GH13443      CDS       T01061                                 

Definition
GH13443 gene product from transcript GH13443-RA
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
dgr  Drosophila grimshawi
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dgri_GH13443
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     Dgri_GH13443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 280 aa AA seqDB search
MLKRKLEQQAAPASGQSLSKTTTLPGITTSALFAQPFWMQFYEIECALNEQLSTFELPPN
LSCTYNPVDYAAALHCAYLRHFLTKPKRVIFIGMNPGPNGMGQTGVPFGNIRTVREMMQL
SGEVRQPPVLHPKRAVDGLNCQIEEPSGVRLWGLIERLADGSLDTFAQQCFVHNFCPLAF
FDEAGRNITPSELKGVHKQQIRDMCLGALEQQLQLLRPQIVVAVGDYVHTVLQRSNYCKS
VAVHRLPHPSPRALNNTNWPKKAEAFLAQHDLIKFMRNET
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaacgaaaactggagcagcaagcggcgccagcatcgggtcaaagcttgtcaaag
acaacaacgctgcctgggataacaacatcggcgttgtttgctcaaccattttggatgcag
ttctacgaaattgagtgcgcattaaatgaacaactttcgacgtttgaactgccccccaac
ctcagttgcacctacaatcccgtggattatgcggcggccttgcattgcgcttatttgcga
cacttcctgaccaaaccgaagcgcgtcatattcattggcatgaacccgggacccaatggc
atgggccagacgggagtaccctttggcaacattcgcaccgtgcgtgaaatgatgcaactc
tctggagaagtgcgtcagccaccggttttgcatccaaagcgtgcggttgacggcttaaat
tgccagattgaggagccgagcggtgtgcgattgtggggattgatcgaacgtttggctgac
ggcagtctggacacttttgcgcaacagtgctttgtccacaacttctgcccactggcattc
ttcgatgaagccggacgcaatattacgcccagcgagctgaaaggtgtccacaagcagcag
atacgtgatatgtgcctgggggcattggagcagcagctgcagctgctccgtccgcagatt
gtggtggcagtgggcgattatgtgcacacagtgctccaacgttcaaattattgtaaatcg
gtagctgtccatcgcttgcctcatccatcgccacgggcgttaaacaacaccaattggcca
aagaaggctgaggcgtttctggcgcagcacgatttgattaagtttatgcgtaatgagaca
taa

DBGET integrated database retrieval system