KEGG   Drosophila grimshawi: Dgri_GH13452Help
Entry
Dgri_GH13452      CDS       T01061                                 

Definition
GH13452 gene product from transcript GH13452-RA
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dgr  Drosophila grimshawi
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 516 aa AA seqDB search
MCFRRHQFGLQFPLLLLLVALVAGKTKTSAVQEDIGDYKDFKKLLRTKNNVLTLYVSSAK
EAAAELKVFREAAEAIRGTGTMLYVDCGNQERKKLCKKLKVTPAPYTLRHYKDGDYHKDY
DRQLTVGSMITFMRDPAGDLPWEEDPAGSDVLHFNDAATFTKHMRKDIRPMLVMFHVPWC
GFCKRMKPDYSKAATELKAQGGYLLAAMNVERQENAAVRKLFNLTGFPTLIYFENGKMRF
TYEGENTKDALVAFMLNPNVKPTTKPKEPDWSADTNSEIVHLTTQGFEPALKDESSVLVM
FYAPWCGHCKRMKPEYEKAALEMKQSNVPGVLAALDATKEPSIGEKYKVKGYPTVKYFVN
GVYKFDVSVREASKIVEFMRDPKEPPPPPPPEKSWEEEAESSEVLFPNDETFTSTLKRKK
HALVMFYAPWCGHCKHTKPEFTAAANALQDDPRVAFVAVDCTQYAALCAKYNVRGYPTLI
YFSYLKTKLEYNGGRTSKDFIAYMNNPPSGKEHTEL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttcgtcgccatcaatttgggctgcaatttccgctgctgttgttgctggtggca
cttgttgccggcaaaacgaaaacatccgctgtgcaggaggacattggagactacaaggac
tttaagaaactgctgcgcaccaagaacaacgttttgaccctgtacgtgtccagcgctaag
gaggctgccgcggaattgaaggtgtttcgggaagcggcggaagcgattcgtggtacagga
accatgttgtatgtggattgtggcaatcaggagcgtaagaagctctgcaaaaaactgaag
gtgacgcccgcaccgtatacactgcgtcactacaaggatggtgactatcacaaggactac
gatcggcagctgactgttggctccatgatcacatttatgcgcgatcccgctggcgatttg
ccctgggaagaggatcccgccggttcggatgtgttgcatttcaatgatgccgccacattc
accaaacatatgcgcaaggacatacggcccatgctcgtcatgttccatgtgccgtggtgc
ggcttctgcaagcgcatgaagccggactacagcaaagctgcaacggaactcaaagcccaa
ggtggatatctgttggccgccatgaatgtggagcgccaggagaatgcagccgttcgcaag
ctgtttaacttaactggttttccaaccttaatttacttcgagaatggcaagatgcggttc
acctatgagggcgagaatactaaggacgcactggttgcctttatgctgaatccgaatgtc
aagccaacgactaagccgaaggaacccgattggtcggctgatacaaactcggaaattgtg
cacctgacaacgcagggctttgagccggcacttaaggatgagagctcggtgctggtcatg
ttctatgcaccctggtgtggccattgcaaacgcatgaaaccggagtacgagaaagccgca
ctcgagatgaagcaaagcaatgtgccgggcgtgctagccgcactggatgccaccaaggaa
ccgtctataggcgagaaatacaaggttaaaggctacccaactgtaaaatactttgtcaat
ggtgtctacaaattcgatgtgagcgtacgcgaagcgtccaaaatcgttgaatttatgcga
gatcccaaagagccaccaccaccgccgccgccagagaagagctgggaggaggaggcggag
agcagtgaggtgctcttccccaatgacgaaacttttacgtcgacactgaagcgcaaaaaa
catgcactggtcatgttttatgcaccatggtgcgggcactgtaagcatacaaagccggag
tttacggccgctgcgaatgcgttgcaggatgatccgcgcgttgcctttgttgccgtcgat
tgtacccaatatgcggcattgtgcgccaaatacaatgtacgcggatatcccaccttaata
tacttttcatacctcaaaactaagctggaatacaatggcggacgcaccagcaaagatttc
attgcctacatgaacaatccgcccagcggaaaggagcacaccgaactgtga

DBGET integrated database retrieval system