KEGG   Drosophila grimshawi: Dgri_GH13452Help
Entry
Dgri_GH13452      CDS       T01061                                 

Definition
(RefSeq) GH13452 gene product from transcript GH13452-RA
  KO
K09583  protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dgri_GH13452
Chaperones and folding catalysts [BR:dgr03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dgri_GH13452
Membrane trafficking [BR:dgr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    Dgri_GH13452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 AhpC-TSA OST3_OST6 Thioredoxin_6 Redoxin Thioredoxin_3 Thioredoxin_9
Motif
Other DBs
NCBI-GeneID: 6566693
NCBI-ProteinID: XP_001992782
FlyBase: FBgn0120928
UniProt: B4JP77
AA seq 516 aa AA seqDB search
MCFRRHQFGLQFPLLLLLVALVAGKTKTSAVQEDIGDYKDFKKLLRTKNNVLTLYVSSAK
EAAAELKVFREAAEAIRGTGTMLYVDCGNQERKKLCKKLKVTPAPYTLRHYKDGDYHKDY
DRQLTVGSMITFMRDPAGDLPWEEDPAGSDVLHFNDAATFTKHMRKDIRPMLVMFHVPWC
GFCKRMKPDYSKAATELKAQGGYLLAAMNVERQENAAVRKLFNLTGFPTLIYFENGKMRF
TYEGENTKDALVAFMLNPNVKPTTKPKEPDWSADTNSEIVHLTTQGFEPALKDESSVLVM
FYAPWCGHCKRMKPEYEKAALEMKQSNVPGVLAALDATKEPSIGEKYKVKGYPTVKYFVN
GVYKFDVSVREASKIVEFMRDPKEPPPPPPPEKSWEEEAESSEVLFPNDETFTSTLKRKK
HALVMFYAPWCGHCKHTKPEFTAAANALQDDPRVAFVAVDCTQYAALCAKYNVRGYPTLI
YFSYLKTKLEYNGGRTSKDFIAYMNNPPSGKEHTEL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtgttttcgtcgccatcaatttgggctgcaatttccgctgctgttgttgctggtggca
cttgttgccggcaaaacgaaaacatccgctgtgcaggaggacattggagactacaaggac
tttaagaaactgctgcgcaccaagaacaacgttttgaccctgtacgtgtccagcgctaag
gaggctgccgcggaattgaaggtgtttcgggaagcggcggaagcgattcgtggtacagga
accatgttgtatgtggattgtggcaatcaggagcgtaagaagctctgcaaaaaactgaag
gtgacgcccgcaccgtatacactgcgtcactacaaggatggtgactatcacaaggactac
gatcggcagctgactgttggctccatgatcacatttatgcgcgatcccgctggcgatttg
ccctgggaagaggatcccgccggttcggatgtgttgcatttcaatgatgccgccacattc
accaaacatatgcgcaaggacatacggcccatgctcgtcatgttccatgtgccgtggtgc
ggcttctgcaagcgcatgaagccggactacagcaaagctgcaacggaactcaaagcccaa
ggtggatatctgttggccgccatgaatgtggagcgccaggagaatgcagccgttcgcaag
ctgtttaacttaactggttttccaaccttaatttacttcgagaatggcaagatgcggttc
acctatgagggcgagaatactaaggacgcactggttgcctttatgctgaatccgaatgtc
aagccaacgactaagccgaaggaacccgattggtcggctgatacaaactcggaaattgtg
cacctgacaacgcagggctttgagccggcacttaaggatgagagctcggtgctggtcatg
ttctatgcaccctggtgtggccattgcaaacgcatgaaaccggagtacgagaaagccgca
ctcgagatgaagcaaagcaatgtgccgggcgtgctagccgcactggatgccaccaaggaa
ccgtctataggcgagaaatacaaggttaaaggctacccaactgtaaaatactttgtcaat
ggtgtctacaaattcgatgtgagcgtacgcgaagcgtccaaaatcgttgaatttatgcga
gatcccaaagagccaccaccaccgccgccgccagagaagagctgggaggaggaggcggag
agcagtgaggtgctcttccccaatgacgaaacttttacgtcgacactgaagcgcaaaaaa
catgcactggtcatgttttatgcaccatggtgcgggcactgtaagcatacaaagccggag
tttacggccgctgcgaatgcgttgcaggatgatccgcgcgttgcctttgttgccgtcgat
tgtacccaatatgcggcattgtgcgccaaatacaatgtacgcggatatcccaccttaata
tacttttcatacctcaaaactaagctggaatacaatggcggacgcaccagcaaagatttc
attgcctacatgaacaatccgcccagcggaaaggagcacaccgaactgtga

DBGET integrated database retrieval system