KEGG   Drosophila grimshawi: Dgri_GH13713Help
Entry
Dgri_GH13713      CDS       T01061                                 

Definition
GH13713 gene product from transcript GH13713-RA
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
dgr  Drosophila grimshawi
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dgri_GH13713
   00330 Arginine and proline metabolism
    Dgri_GH13713
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Dgri_GH13713
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Dgri_GH13713
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Dgri_GH13713
Enzymes [BR:dgr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     Dgri_GH13713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 341 aa AA seqDB search
MLRVAVIGAGVNGVACAIKILEHYQDEKKTNVQVTIISDEFTPNTTGDGSAGLWGPYLLG
GTDESKVHKWSRDMHLFLEKIWLSEDAGEAGVCLIPCVRLSTDPNASVGEFWRDIVYGAV
DLTAEQLTAYNKNRDIKFTSGLSFVTYTSEPVKLLPYLTKRFVRRGGRIEQQKVTDLETF
VRDSPYDVIVNCTGLGSRQLLNDDSMYAVRGQVTRIKANWVFTAILDESDVGNYIIPNTE
SVVLGGTHQVKDYSTKVCETDKRFIIDGCRSLMPALEHTQHLFDWVGLRPGRDQLRLESE
RRGRKLLIHNYGHGGSGVTLAWGCADDVLSLLVAAQIKSHL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgagagtagcggttatcggagcgggtgttaacggtgtggcgtgtgcaatcaaaatc
ttggagcattaccaagacgaaaagaagacaaatgtgcaggtgacaattatatctgatgaa
tttacgcccaacacaaccggcgatggatcagcgggactgtggggcccctatttgctaggt
ggcacagatgagtcaaaagttcataaatggtcgagggatatgcatttgtttctcgagaag
atttggctaagtgaggacgctggcgaggcgggcgtctgcctcatcccctgcgtccggttg
agcaccgatcccaatgctagcgttggcgaattctggcgcgacattgtctacggtgccgtc
gatctcacagcagaacaactgactgcttataataaaaaccgagatattaaatttacttcg
ggactctcatttgttacttatacatccgagccggtcaagctgctgccctatctgacgaag
cgctttgtccgtcggggtggacgcattgaacagcagaaagtcacagatctggagaccttt
gtgagagattcgccctacgatgtgattgttaattgtactggattgggctccaggcaactg
ctcaacgatgatagcatgtacgccgttcgtggtcaagttactcggataaaggccaattgg
gtgtttaccgccatactggatgaaagtgatgttggcaactatatcatacccaataccgag
tccgtggtgcttggcggcacacaccaggtgaaggattatagcaccaaggtctgtgagacg
gataagcgtttcattatcgatggttgtcgcagcttgatgccggctctggagcacactcag
catctattcgattgggttggtctgcgtccgggtcgcgaccagctgcgtctggaatcggag
aggcgtggcaggaagttactcattcacaactatggacatggtggcagcggtgtcaccttg
gcctggggctgtgccgacgatgttctaagcctcttggtagctgcacaaattaaatcccat
ttgtag

DBGET integrated database retrieval system