KEGG   Drosophila grimshawi: Dgri_GH13734Help
Entry
Dgri_GH13734      CDS       T01061                                 

Definition
GH13734 gene product from transcript GH13734-RA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dgri_GH13734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 851 aa AA seqDB search
METNSSSSSTSGSSSSSGSSSCSDTGSSSDSDSSSSGAPRPEEKPQPAKQQQTAVRRKAS
ENEKPKSAAAAGSSSNNNNSSASSNPLASAASKVRAVVASSNQRNGALSSDDDDDDDDDV
DDAPPAKKNPRTISNSVAGAGKGAVAAAASARRKPSTGAAAKQTVAASGSKATLPAKTNG
NNKRPSLSSSSNSTDDSRKEVKNGRKVPLKLASTATAVRAKQMRAKALQAKANSKNGAAG
AGGGGGAAAARRARSRSSDGSDDSDSGSGSETSSMSESEASDSSNSYSSQPPTGKANPKG
KRVIVGDSEEERKDKANPMRKLTRSLSMRRSKQQQQQQLHQPKQPSSETETDPELDREQD
DKQRVHSKSPAKKSAIAAGFSSMNNINNSLSKCKVKKEMTSIKSRPISPAVQLEKKCPIE
GCDSSGHLSGNLDRHFLPEACPIYHNMSASECKERANERRQRNEQRLKLPINIVSTPGNQ
HSNLKSLTPEQREFLAKIRESRSTFRPMSHSFLNDKVKIDKESRDEDREPSLAGLVPDYD
LQLFREAQAQASERIEDELKDLPVGKGIKYISMGKYKMKVWYQSPYPDDAARLPKMYICE
FCLRYQKSETGIKRHAQKCVWRHPPGDEIYRKGKLQVWQVDGKRYKQYCQHLCLLAKFFL
DHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIPFLQEKNSFYNVSCILTLPPYQRKG
YGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRSYWKDVLLDYLCNRSGNTLCIKDVS
QEMAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEYKERVQRRGTFPKIDDSCLRWQ
PFIPAQPSASP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaacagcagctcgagctccacatcgggcagcagctcatcgagtggctcctcc
agctgctccgacaccggcagctcctccgattccgactcgagcagttccggagcaccaagg
cccgaggagaaaccccaaccagcgaagcaacaacaaaccgcagtgcgacgcaaagcaagc
gaaaatgagaaaccgaaatccgccgctgcagccggcagcagtagcaataacaacaatagc
agcgccagcagcaacccgttggcgtcggcagcgagcaaggtgcgcgccgtggtggcgtca
agcaaccagcggaatggcgcactctccagcgacgacgatgatgatgatgatgacgatgtc
gatgatgcgccgccagctaaaaagaatccgcgcacaataagcaacagtgtggcaggtgca
ggaaaaggggcagttgcagctgcagcatcagcaagaagaaagccatcaactggcgcggca
gcaaagcaaacagtggcagcatctggcagcaaagcaacgctgccagcaaaaacaaatggc
aacaacaaacgaccctcgctgagctcctcctcgaacagcaccgatgattcgcgcaaggag
gtaaaaaatggacggaaagtgccgctgaagctggcgagcactgcgaccgctgtgcgagcc
aaacagatgcgcgccaaggcgctgcaagcgaaggcaaacagcaagaatggagcagcagga
gcaggaggaggaggaggagcagctgcagcgcgacgggcgaggagtcgcagcagcgatggc
agcgatgattcggacagtggttccgggtcggagacgagctccatgagcgaatcggaggcc
agtgattcaagcaactcgtacagctctcagccgccgacgggcaaagcgaatccgaagggc
aaacgggtcatcgttggcgacagcgaggaggagcgcaaggataaggcgaatcccatgcgt
aagctcacccgctcgctgagtatgcgccgttccaagcagcagcaacaacagcagctgcac
cagcccaagcagccgagcagcgaaacggaaacggatcccgagctggacagggagcaggac
gacaagcagcgtgtccactccaagagtccagccaagaagtccgcgatagctgccggtttc
agcagcatgaacaacatcaacaacagcctcagcaaatgcaaggtcaagaaggaaatgact
tccatcaaatcgcgacccatctcgccagctgtgcagctggagaagaagtgtccgatcgag
ggctgtgactcctcgggccatctcagtggcaatctggatcgtcactttctgcccgaggcg
tgtcccatctatcacaacatgtccgcctccgagtgcaaggagcgtgccaatgagcgccgt
cagcgcaacgagcaacgcttgaagctgcccatcaacattgtcagcacgccgggcaatcag
cacagcaatctcaaatctctgacgcccgagcagcgagagtttctggccaaaatacgcgaa
tctcgctccacttttcgtccaatgagccacagtttcctaaacgataaggtcaagatagac
aaggagtccagggacgaggatcgtgagccaagtctggctgggcttgtgcccgattacgat
ttgcagctgtttcgcgaggcgcaggcccaggcctccgagcgcatcgaggatgagctcaag
gatctgcctgttggcaaaggcatcaaatatatcagcatgggcaagtacaaaatgaaggtg
tggtatcagtcgccctatccagatgatgccgcccgcctgcccaagatgtacatctgtgag
ttctgtctgcgctaccaaaaatcggagacgggcatcaagcgacacgcccagaaatgcgtt
tggcgtcatccgcccggcgacgaaatctatcgcaagggcaagcttcaggtgtggcaagtg
gatggcaaacggtataaacagtactgtcagcatctctgcctgctagccaagttctttctg
gaccacaagacgctctactatgacgtggagccatttctcttctacatcatgaccttggcc
gatgtcgatggctgtcacattgtcggctacttcagcaagcatattccattcttgcaggag
aaaaactcattctataacgtatcctgtattcttaccctgcctccatatcaacgcaagggc
tacggtcgactcctcattgatttcagctatctgctaaccagagtggagggcaaaattggt
tcgccggagaagccgttgtccgatctgggactcatttcatatcgctcctactggaaggat
gtcctgctcgactatctgtgcaatcgttccggcaacactctttgcatcaaggatgtatct
caggaaatggccatatattcgtatgatattgtcagcacactgcaggcgctgggcatgatg
aaatactggaagggcaagcacattgtactcaaaaagcaggatgtgctggatgagtataaa
gagcgtgtgcagcgacgtggcacattccccaaaatcgacgactcctgcttgcgctggcag
ccatttataccggctcagccgagtgcctcaccttag

DBGET integrated database retrieval system