KEGG   Drosophila grimshawi: Dgri_GH13735Help
Entry
Dgri_GH13735      CDS       T01061                                 

Definition
GH13735 gene product from transcript GH13735-RA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dgr  Drosophila grimshawi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dgri_GH13735
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dgri_GH13735
   00020 Citrate cycle (TCA cycle)
    Dgri_GH13735
   00620 Pyruvate metabolism
    Dgri_GH13735
Enzymes [BR:dgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dgri_GH13735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 504 aa AA seqDB search
MLRSLSATRHELGALRAVFLRSQVSRRGFNGGFRALSSQRCLLGIRTTPNGIPILSRPQI
LSTWNCNFARAYANLPDHIRVPLPALSPTMDRGSIVSWEKKEGDKLNEGDLLCEIETDKA
TMGFETPEEGYLAKILVPGGSRDVPVGKLVCIIVPDEGSIAAFADFKDDSPAGAPAPAAA
AAAPPPPPPVAVPVAAPVAAAPEPPPAAAPGTATAPGGRVYASPMAKKLAETQKMRLQGK
GSGVHGSLKSGDLAASQAAEQPLAHPPAAAPGARFKDIPLTTMRSVIAKRLLESKQNLPH
YYVTVQCQIDKLMEFRAHVNKKYEKEGARVSINDFIIKAIGIASRKVPEANSSWMNTFIR
EYDDVDVSVAVSTDKGLITPIVFGADRKGVLEISRNVKELAGKARANKLQPQEFQGGTIS
VSNLGMFGVNQFCAVINPPQSCILAIGTTTKSLVLAPDSPQGFKEVNMLTVTLSADHRVV
DGAVAAVWLKHFRDFMEDPQTMIL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctacgctctctttctgccacacgacatgaattgggcgcacttcgtgccgtcttcctt
cgctcgcaggtgtcgcgacgtggattcaacggcggatttcgggccttgagcagtcagcga
tgcttgcttggaatcagaacaacacctaatggaataccgattctcagccgaccccaaata
ttgtccacatggaattgcaatttcgcccgcgcctacgccaacttgccggatcacatacgt
gtcccactgccagcactgtcgccaaccatggatcgtggctcgattgtcagctgggagaag
aaagaaggcgacaagctaaatgagggtgatctgctgtgcgagatcgaaacggacaaggcc
accatgggctttgagacgcccgaggagggttatttggccaagattttggtgcctggcggc
agccgggatgtgcccgttggcaagctggtctgcataattgtccccgatgagggtagcata
gctgccttcgcagatttcaaggatgactctcccgctggagctccggcgcctgctgctgct
gctgccgctccaccaccaccaccgccagttgctgtcccagttgctgccccagttgctgca
gcgccagaaccaccaccagccgccgctccaggtaccgctaccgcgccaggcggtcgtgtc
tatgcaagtccaatggcaaagaaattagccgaaactcaaaagatgcgcttacaaggcaaa
ggttccggcgtccatggctcacttaaatctggtgatcttgcagcctcgcaggcggctgaa
cagcctttggcccatccgccggccgccgcgcccggtgcccgcttcaaggacatccccctg
acgaccatgcgcagtgtcatcgccaagcgtctgctggagtccaagcagaatctgccacac
tactatgtaaccgttcagtgccagatcgacaagttgatggagttccgcgcccatgtgaac
aaaaagtatgagaaagagggtgcccgcgtctccatcaacgatttcattattaaggctatt
ggcattgctagtcgcaaggtgcccgaggcgaactcatcttggatgaacacctttataagg
gagtatgacgatgtcgatgtatctgttgcggtctccacggacaagggtctcattacgccc
attgtctttggtgccgatcgcaagggtgtgctggagatctcgaggaatgttaaggagctg
gcgggtaaggcacgcgccaacaagttgcagccacaagaattccagggcggcaccatatct
gtgtccaatttgggcatgttcggtgtcaatcaattctgcgccgttatcaatcctccgcaa
tcgtgcatcctggccattggtacaacaacgaaaagtctggttctggctccggacagtccc
cagggtttcaaggaagttaatatgctgaccgtaacgctgagtgccgatcacagagttgtt
gatggcgccgtggctgccgtttggctgaagcacttccgcgacttcatggaggatccacag
acaatgattctttaa

DBGET integrated database retrieval system