KEGG   Drosophila grimshawi: Dgri_GH14103Help
Entry
Dgri_GH14103      CDS       T01061                                 

Definition
(RefSeq) GH14103 gene product from transcript GH14103-RA
Organism
dgr  Drosophila grimshawi
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 354 aa AA seqDB search
MSNTHLRTAFNSKEDYGITLDILRKEFDERWHNQEPSPYTNLEGYSQRAILGNGSFGTVL
LVKEKKSKNYYAAKMMNKDDLVRLKQVGHVHNEKMVLSSVRFPFLVHLIDSSKDFDYLYL
VLPFINGGELFTYHRKVHKFNEKQSRFYGVQVLLALEYLHHMDLMYRDLKPENILMDARG
YIKLTDFGFTKRVEGRTSTLCGTPEYLAPEIIQLKPYSRSVDWWAFGILLYEFVAGHSPF
SLHSRDVIVMYSKICLADYRVPSSFTCNLKHLVDSLLQVDSSKRLGNSPEGSADIKSHPW
FQGVDWYAMLNQEISPPYTPTVSNIEDLSNFDNFEPKSKSKSKINRHPDLFTNF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacacgcacctgcgaacagcattcaattcaaaagaggactacggcatcacactt
gacatccttcggaaggagttcgacgagcgttggcataaccaggagccgtcaccctacacc
aatctcgagggctactcacagcgagcgatccttggcaatggcagctttggcactgtcttg
cttgttaaggagaagaagagcaaaaattattatgcggccaagatgatgaacaaggacgat
ttggtgcgtctcaaacaggtcggacacgttcacaatgagaagatggtgctgagttctgtg
cgatttccatttctggtccatttaatcgattcctccaaggactttgactatctgtacctg
gtcttgccgtttattaatggcggcgaactcttcacctatcatcgcaaagtgcacaagttc
aatgagaaacagtcccgtttctacggcgttcaagtgctgcttgctctcgagtatctgcat
cacatggatctcatgtatcgcgatctcaagcccgagaatatattgatggatgctcggggc
tatatcaagctgaccgattttgggtttacaaagcgtgttgagggtcgaacgtcgacactt
tgtggcactcccgagtatttggcacccgagatcattcagctgaaaccctatagtagatct
gttgattggtgggcatttggtatactcctctatgagtttgtcgctggccattcgccgttc
tcgttacacagtcgtgacgtcatcgtgatgtattcgaaaatctgtctggccgattatcga
gtaccatcatcgtttacgtgcaatctgaagcatctggttgactctctgttacaggtggac
tcctcaaagcgtttaggtaactcaccggagggctccgcagatataaagagtcatccctgg
tttcagggcgtcgattggtatgcgatgctcaatcaggaaatatcgccaccctatacaccg
acagtatccaatattgaagatctatcaaattttgacaattttgagcctaaatctaaatcg
aagtccaaaataaatcgccatcccgatttgtttactaatttttaa

DBGET integrated database retrieval system