KEGG   Drosophila grimshawi: Dgri_GH14199Help
Entry
Dgri_GH14199      CDS       T01061                                 

Definition
GH14199 gene product from transcript GH14199-RA
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
dgr  Drosophila grimshawi
Brite
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dgri_GH14199
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH14199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2889 aa AA seqDB search
MTFDTRRAQGNTGTGQATTNNSSNNSNNPAATTGITSTAQTGTGTVTGSVTVPATAVTIT
TTTSTAAITAATTTTTNMMSSGIGGDSNNSTTNSQEHLQATEATTAAAAAAAVVDTSETT
VSPEKLIASFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELAQAGADHDCEPCV
EFYRNGLTTSFAKILTDEAVNSWKYNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIV
FDPDNKFNTFNGARQPECFAAPECIWGVLDSNKMFAKSPAEPKPPRGWLVDLINRFGQLG
GFDNLLERFNSGLELLRRHQSSATNKVKVETENAGGQDNRLTLALIHSLLRPFGQCYELL
TPATIAKYFMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARFLASRLSGQEE
LIRDLEMFRLKMILRLLQVSSFNGKMNALNEINKVLSSVAYYSHRSQPLPHNLPEDEMDW
LTAERMAQWIKSSDVLGIVLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAG
KHEAIVKNMHDLLAKLAWDFTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKN
GVMAQKVLKLFWTLAHSQEVPPEVLDQALGAHVKILDYSCSQERDAQKTIWLDKCVGELK
SGDSWVLPALRLIRDICCLYDMTPNHAPRTQTGTNRLQVIERLQNDYSLVILVTNSLTAY
MEKVRSLVNETPTLDAATILIDGRFPHHAQIAERLEFLKFLLKDGQLWLCADQAKQIWHC
LAVNAVFTADREECFRWFGKLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFERF
FKAVNSKEDKLKAIHRGYILDNEDLIGKDYLWRVITTGGEEIANKAIDLLKEVSTALGPR
LQEHITEFHEMFIGECCSRLRTHYSNILILGKTMLVEDNAENNAANDESKDSKMRYIEAE
KMCRIIKVLQEYIKECDRSFSGDRIHLPLSRVTRGKNTSLYIRFQTPGRPIDDLEIVTHS
NETMAAFKRNLLKRIKGNNSSSSSTTNSNATTNIKVDLFYTNGELIEITDEINPLYQYTI
RDKMILTAKLTPVGIGLASSPDSSSDSSTGSPPRPCPDMQRVESESTLPGVIISQNYQYT
EFFLKLYQLGSDLEHGRLRDSAKVLLHLLPCDRHTMRQLQLMCRVPKSTASTGDGPKEPE
DVGGDAALNADDCTPEQMFLHPAPAQVLYNLSVLHGLLIPALDPLGEAALQVQSSWMHSG
CAHFVLELLTKNNFLPNADMHTKRASFQGVLRLAKLFLYIVGSVLSRVGDEPMICDYDNG
ARSQVDILKQNFSTMPNNAQGTLHAISAKLAEILATEMLSASHEGERCRALFSSTLQWSC
PDISTIKAVVQLAWASSCGNLQALGSCSNNSNKSADFEDDAIVPDGQDFSMCKEALEVMT
ISFILNPSANEALSNDANWPKFITSIVLKNPMRHVRQVASEQLFLASTYCAGDRRPFVYM
VNLLVSALKTLVPQYEATCAEFFSILCRTLAYGCIYNWPLQIGEHLLGDEIKWLRKIREN
VKITGDTQVHEELLEGHLCLAKELMFFLMPDSKAQLNELIHELIDDFLFTASREYLHLRK
HGSLRMDTVPPPVCRSPHTIAAACDLLIALCQLCVPNMKLLTNTLIDFVCTDTDPLREWD
YWPPVGARAAKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILKAHGAATNDNEDFSGDS
DLNSSGNNSSGANLGPSFFGPAPMPTLASTSSAASTSLDDATGGASDVRKNYHVVILKHV
QAIFAHLGHSALQFYVPRGLWTHFKLQGEPVNLREQQDAVEFFMSLFESLDEGLKALGYT
QLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTESLEQYVKGELLEGAD
AYHCDKCDKKVVTIKRLCVKKLPPVLAIQLKRFEYDYERVCAIKFNDYFEFPRILDMEPY
TVSGLAKLEGEVVEVGDNCQTSVETTKYELTGIVVHSGQASGGHYFSYIVSKNPANGKCQ
WYKFDDGEVTECKMHEDEEMKLQCFGGDYMGEIYDNNLKRMQYRRQKRWWNAYMLFYTRC
DQNPKQFETSVEQLSLTESRNVVLPLPKPIERSVRHQNIRFLHSRSIFSVEFFNFIKKLV
SCSIPSTRSDKITPAAEELSLLGVQLASQFLFHTGFRTRKSLRGPVIEWYDTLSHHIRSS
SLVRKWFANHALLSPPSRLGEYILMAPSPEVRTVFVKLVVFFCHFAINDEPLVGYEGSNL
CEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGLGTREKQQLLKLNVPVQFMQVAMDD
GPGPSIKYQYPEFSKLHQVVSHLVRCSDVSDKCQSSNQNGRPLPNPYKDASIAQEEMTPL
SSECMDILFNRTSYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRAVLTELLWQCGYAYCH
DMRHHTDLLLNILLIEDSWQHHRIHNALNGVAEEREGLLDTIQRAKTHYQKRAYQIIKCL
TQLFHKSPIALQMLNTNPTISRHWSVAVEWLQDELERQRGIGCQYNSYSWSPPAQSNDNT
NGYMLERSQSAKNTWSMAYELCPEEVSEKPTSTEENNESDLESNDDNKQQTEQQATAAAT
PAATAIGTDATTLNEQPDNKLTTTIIPTIGGWPGPAPSSSTPTSASTLPAGTCSSSTSSS
DVVGGSGKSRLSRQLFNAYASTGGVNVAATSAGGSGGNSETESSAQETGGNNTESNINGL
TNSLDHIKISMEKQSSHRKERRRSLKKKIVFGNAEEEEEEEEEADEMVTTTEATTTTAAP
TTVSSVTTATTTTGTTAAVTVAVDSTTTALITLTDTTTTAANNITAATTSTATTTGAAKL
NSTVEKNLI
NT seq 8670 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgatacgcgccgggcacaaggcaacacaggcacaggccaagccacaaccaac
aacagcagcaataacagtaataatccagctgcaacaacgggcataacgagcacagctcaa
acgggaacaggaacagtcacgggatcagtcactgtgccagcaacagcagtcacaataaca
accacaacatcaacagcagcaataaccgcggcaacaacgacaacaacgaatatgatgtcc
agtggcattggtggcgactccaacaacagcaccaccaacagtcaggaacatctccaagct
acggaggcgacaacagcagcagctgcagcagcagccgtcgtggataccagtgagacgact
gtgtcaccggaaaagctgatagcgtcatttccaacgacaaaactgcgctcgctgacacag
aagatatcgaatccgcgttgggtggttcccgtgctgcccgaacaggagctggaggtgctg
ttaaatgccgctatcgaattggcccaagctggtgccgatcatgactgtgaaccatgcgtg
gaattttatcgcaatggtttgactacatcgtttgccaaaatcctcaccgatgaggcggtc
aattcatggaaatataatatccatcattgcattttggtgtcttgtggcaaattgttgcat
ctgattgcgatacatatgcaacgtgataatccctatttgcttgatctactggcgattgtc
ttcgatccggataataagttcaatacgtttaatggcgcccgtcaaccggagtgttttgcg
gcgcccgaatgcatttggggtgtgctcgatagcaataagatgtttgccaaatcgccggca
gaaccaaaaccgccacgtggttggctcgtcgatctcattaatcgcttcggccagttgggc
ggctttgataatctcctcgagcgtttcaatagcggtttggagttgctaaggcgccatcaa
tcctcagccacaaataaggtgaaagtggagacggagaatgccggtggacaggataatcgt
ttgacgttggcgctgatacacagcctgctgcgcccatttggtcagtgctatgaactctta
acgccagctacgattgccaagtactttatgcccacttggaatgtggtcttggatctgctc
gacagtttcacggatgaggaactgaagcgggaggtgaagcccgagggacgaaacgattat
atcaatggtattgtgaagtcggcccgctttctcgccagccgtttgtctggtcaagaggaa
ttgatacgtgatctggaaatgtttcgcctgaagatgatattacgtctgctgcaagtgtcc
agtttcaatggcaaaatgaatgcactgaatgagattaataaagtgctctcctccgtcgct
tactattcgcatcgatcgcaaccgttgccccacaatctgcccgaggatgaaatggattgg
ttgacagcggagcgcatggcccagtggatcaagtcatccgatgtgctgggtattgtgctc
aaggactcactgcatcagccccagtatgtggagaagctggagaagattatacgttttctg
atcaaggagcaggcgctaacgctcgacgatttggatgcagtgtggcgtgcacaggcgggc
aaacatgaggcaatcgttaagaatatgcacgatctgttagccaagttagcctgggatttt
acgcccgagcagctcgatcatctcttcgaggcatttcaggccagcatgacgacggcgaat
aagcgtcagagggaacgtttgctggagctaatacgccgtctcgccgaggacgataagaat
ggcgtgatggcgcagaaggtgctgaagctcttctggacgctcgcccactcgcaggaagtg
ccgcccgaggtgctcgatcaggcgttgggcgcccacgtcaaaatactcgactacagttgc
tcgcaggagcgagatgcccagaagaccatttggctggacaagtgcgtcggtgaacttaaa
tccggtgattcttgggttttgcccgctttgcgtttaattcgcgatatttgctgtttgtac
gatatgacgccgaatcatgcgccacgcacccagacgggcactaatcggctccaggtcatt
gaacgactccaaaatgattattcgttggtgatcctcgtcacaaatagtttgacggcgtat
atggaaaaggtgcgctccttggtcaatgagacgcccaccttggatgcggcaacaattctg
atcgatggccgttttccgcatcatgcacagattgcggaacgtttggagttcctgaaattt
ttgctaaaggatggtcagctctggctctgtgccgatcaggcgaaacaaatttggcattgt
ttggctgtgaatgccgtttttacggcagatcgtgaggaatgtttccgctggttcggcaaa
ctgatgggcgaggaaccggatctcgatcccggaatcaataaggatttctttgagaataac
atactgcaattggatccacatttgctcacagagagtggcatcaagtgttttgagcgtttc
ttcaaggctgtcaattccaaggaggataagctgaaggccattcatcgtggttatatcttg
gataatgaggatttgattggcaaggattatttgtggcgtgtcataactacaggtggcgaa
gagattgccaacaaggccatcgatctgctcaaagaggtttccacggcgttggggccacgt
ttgcaggagcatatcaccgaattccacgagatgttcattggcgaatgttgttcccgtttg
cgcactcattatagcaatatcctgatattgggcaaaaccatgctcgtcgaggataatgcc
gagaataatgcggccaatgatgagtccaaggacagtaaaatgcgttatattgaggcggag
aaaatgtgtcgcatcatcaaggtgctgcaggagtacattaaggaatgtgatcgttccttt
agcggtgatcgcattcatttgcccctgagtcgtgtgacgcgtggcaagaacactagtctc
tacatacgtttccagacgcccggacgacccatcgatgacctcgaaattgttacgcatagc
aatgaaacaatggccgcattcaagcgtaatcttctcaagcgcatcaagggcaataatagt
tcctcctcatcgacgaccaactcgaatgcgacgaccaacatcaaagtggatctcttctat
acgaatggtgaactgatcgaaatcaccgatgaaatcaacccactctatcaatacaccata
cgcgacaagatgatattgacggcgaagttgacaccagtgggcattggcctcgccagcagt
cccgattcatcgagcgattcgagcactggttcaccacccagaccctgtccggatatgcaa
cgtgtcgaatcggagtcgacgctgcccggtgtgattatctcccagaactatcaatacacc
gaattctttctcaaactgtatcagctgggtagtgatctagagcatggtcgtctgcgggat
agcgccaaggtgctgttgcatctgttgccctgcgatcgacacacaatgcgacagctgcaa
ctgatgtgtcgtgtgcccaagtcaaccgccagcaccggtgatggacccaaggaaccggag
gatgtcggcggtgatgctgctctcaacgctgatgattgcacgccggagcaaatgtttctg
cacccggcgccagcgcaggtgctctacaatttgagtgtgctccatggcctgctaataccc
gctttggatccactcggggaggcagcactccaagtgcaatcttcgtggatgcattcgggc
tgtgcgcattttgtgctggaattgctgacgaaaaacaattttctgcccaatgccgatatg
catacgaagcgcgcctcgttccagggtgtgctgcgactggccaaactcttcctctacatt
gtgggcagtgtgttgtcgcgtgtcggcgatgagcccatgatttgtgactatgataatggc
gcccggtctcaggtggatatactcaaacagaacttttccacaatgccgaataatgcacag
ggcacgttgcatgcaatttccgccaagctggcggagattctcgccaccgagatgctttcc
gcgagtcacgaaggtgaacgttgtcgtgccttgtttagttcaacgttgcaatggtcctgt
ccagatattagcaccattaaagcggtcgtccaattggcctgggcctcatcgtgtggcaac
ttgcaggcgctgggcagttgcagcaataatagcaacaaaagcgccgacttcgaggatgat
gccattgtgccggatggtcaggattttagcatgtgcaaggaggcactcgaagtgatgacc
atttccttcatactcaatcccagtgcaaatgaggcgctgagtaacgatgccaattggcct
aagtttattacatccattgtgctgaagaatccgatgcgacatgtgcgtcaagttgcctcc
gaacaattgtttttggcctccacttattgtgccggggatcgtcgtccctttgtctatatg
gtcaatttgttggtgagcgcgttgaaaacgttggtgccacaatatgaggcaacgtgtgcg
gagttcttttcgatactgtgtcggactttggcctacggctgcatctacaattggccactg
caaattggcgaacatttgctcggtgatgagattaaatggttgcgtaaaatacgcgagaat
gtcaaaatcactggcgatactcaggtgcacgaggagttgttggagggtcatctgtgtctg
gccaaggagttgatgttcttcctcatgcccgattctaaggcacagctgaatgaacttatc
catgagctcatcgatgactttctgtttacggcctcgcgcgaatatctgcatttacgcaag
catggcagtctgcgaatggacaccgtgccacctcccgtctgccgcagtccgcatacaatt
gcggccgcttgtgatctcctcatcgctctgtgccagctctgtgttcctaatatgaagcta
ctcaccaacacactcatcgatttcgtttgcacggatacggatccgttgcgcgaatgggat
tattggccgccggttggagcacgggcagcgaaaggtttctgtggcctgaagaatgcgggt
gccacatgctacatgaactcggtgctgcaacagctgtatatggtgcccgctgtgcgtgtg
ggtatcctcaaggcgcacggtgccgccaccaatgacaacgaagactttagcggcgactcc
gatttaaatagcagcggcaacaacagcagtggcgccaatctgggcccctcgttctttgga
cccgccccaatgcccacgcttgcatcaacatcatcggcggcatcgacgtccctggatgat
gccactggtggtgcctccgatgtgcgcaaaaattaccatgtggtcatcttaaagcatgtg
caggccatattcgcccacttggggcacagtgcgttgcagttttatgtgccacgcggcctc
tggacgcacttcaaattacaaggcgagccagtgaatttacgcgaacaacaggatgccgtt
gagttcttcatgtcgctgttcgagagcctcgatgagggtctgaaggcgttgggctacacg
caactgatgaatgcaacgttgggcggctcgtttagcgatcagaagatatgccaagagtgc
ccacatcgctactccaaagaggaaccatttagcgtatttagtgttgatattaggaatcat
agctcattaaccgaatctctggagcagtatgtcaagggagagctgctcgagggagctgat
gcataccattgtgataaatgtgataaaaaagtagttaccattaagcggctatgcgtgaag
aaactgccgcccgtgttagccatacaattgaaacgctttgaatacgactacgagcgcgtt
tgtgcgattaagtttaatgattattttgaatttccgcgtatactcgatatggagccctac
acagtttccggcctagctaagctagagggcgaagttgtggaagtgggtgataattgtcaa
acaagtgttgaaacaacaaaatacgaactgaccggcattgtggtgcacagcgggcaggca
tccggtggccactacttcagctacatagtctccaaaaatcctgcgaatggcaagtgtcag
tggtacaagttcgatgatggcgaggtaaccgaatgcaaaatgcacgaggatgaggaaatg
aaattacaatgcttcggcggcgactatatgggcgagatctacgacaacaatctgaagcgg
atgcaatatcgccgtcagaagcgctggtggaatgcctatatgctattttatacgcgctgc
gatcagaatcccaaacagtttgagaccagcgtcgagcagttgtcgctaaccgagagtcgc
aatgtggtgctgccgctaccaaagccaatcgaacgcagcgttagacatcagaatattcgt
tttctgcattcgcgcagcattttctcggtggagtttttcaatttcattaaaaagctggtc
agttgcagtattccttcgacgcgcagcgataagattacacccgctgctgaggagctatcg
ctgctgggcgtgcaattggcatcacaatttttgttccacactggatttcgcacaaggaaa
tcgctgcgtggtcccgtcatcgaatggtatgacacgctttcacatcacatacgttcctcg
tcgctggtgcgcaaatggtttgcgaatcatgcgctgctctcgcccccatcgcgtttgggc
gaatatatattgatggcaccatcgccagaggtgcgcaccgtgttcgtcaagctggttgtg
ttcttttgccattttgccatcaatgatgagccgctcgttggctatgagggcagcaatctg
tgcgaacaggtcctgatcagtgtgctccgtctgctcaaatctgaggcggctgactatggc
aagcatttaccgcactactttagcctcttcagcatgtatgtgggcctgggcacacgcgag
aagcagcagctactcaagctgaacgtgcccgtccagtttatgcaggtggccatggatgac
ggacccggtccatcgattaagtatcagtatcccgagttcagtaagctgcatcaggttgtc
tcgcatctggtgcgttgcagcgatgtcagcgataaatgccagagctccaatcagaatggt
cgaccactgcccaatccgtacaaggatgcgagcattgcccaggaggagatgacgccgctc
tccagtgagtgcatggatatactcttcaatcgcaccagctacatcaaaaaggtgatcgag
gacaccaatgtgggcgatgagggattgaaactgttgcagtattgcagctgggagaatcca
cacttctcgcgtgccgtgctcactgaactgttgtggcaatgtggctatgcctattgccac
gatatgcggcaccacacagatttgctgctgaacatcctattgattgaggattcgtggcaa
catcatcgcatccacaatgcactcaatggtgtcgccgaggagcgcgagggtctgttggac
acgatacagcgggcgaagacgcattatcagaagcgtgcctatcaaataatcaaatgttta
acgcaactgttccacaagtcaccgatagcgttgcaaatgttgaacacaaatccaacaatt
agtcggcattggagcgtggccgttgaatggctgcaggatgagctggaacgacaacgtggc
attggctgccaatacaactcctattcgtggtcaccgcccgcgcagagcaatgataatacc
aatggctatatgctggaacgttcgcaatcggccaagaacacatggtcgatggcctacgaa
ctgtgcccggaggaggtgagcgagaaaccaacgtcgacggaggagaacaacgagtccgat
ttggagtccaacgatgacaacaaacagcaaacggagcagcaagcaaccgcagcagcaacg
ccagctgcaactgcaattgggacggatgcaacaacgctcaatgagcagccggataataaa
ctaacaacgacgatcatcccaacaattggtggctggccgggaccggcacccagctcatca
acgccaacctcagcgtcaacgctgccagcgggcacctgctccagctccacctcttcctcg
gatgttgttggtggcagtggcaagtcgagactctcgcgtcaactgttcaacgcctatgcc
tcgacgggtggcgtaaatgtggcagcaacaagtgccggtggcagcggcggcaacagtgaa
accgagagcagtgcccaggagacgggcggcaacaacacggagtccaacataaatggactc
accaatagcttggatcacattaaaatctccatggaaaagcagtcgtcgcatcggaaagag
cgaagaaggtcattgaagaaaaagattgtgtttggaaatgcggaagaggaggaggaggag
gaggaggaagccgacgaaatggtaacaacaacagaggcaacaacaactacagcagcacca
acaacagtgtctagcgtcacaacagcaacaacaacaacaggaacaacagcagcggtaaca
gttgctgttgactccacaacaacagcactaataacattaacagacacaacaacaacggca
gccaataacataacagcagcgacaacatccacagcaacaacaacgggagcggctaagctc
aactcaacagtggaaaaaaacttaatttaa

DBGET integrated database retrieval system