KEGG   Drosophila grimshawi: Dgri_GH14306Help
Entry
Dgri_GH14306      CDS       T01061                                 

Definition
GH14306 gene product from transcript GH14306-RA
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
dgr  Drosophila grimshawi
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    Dgri_GH14306
Enzymes [BR:dgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dgri_GH14306
Peptidases [BR:dgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dgri_GH14306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1136 aa AA seqDB search
MHEYDINELREEQARLPTSTSSTSTSSKNNCRNNQQQLQQQIHIQSPRQETTTLHLLQQS
QQEASTNLIATDDPQQLSPSSSYSSATYPATQHEYTDPIVEPPKAKVEVQVPKRRRQRRV
YVAEFSRCASLRSRQLAPVEVIPLPEIPLTPSPTPTEVIEDHKSYYIKPEHFNSEFWNRI
EEVPEVKPTGRKRRGAVGFRNRKRRNRPDLDTSSIFSPETTAAIAAAQIELDSAKPVSRA
FRKRKLSSGNMSLYDRRYQTSNDEQRRVANGYAGGNGLRAGNSAGAGDIDTADLQITHHY
YVPGVGGSSSSSIATTGTGSGLNGSVGGGSGSAALNHVPAMGTLCNIGNTCYLNSVVYTL
RCAPHFLHNLHHLIHDLNVVQQTMLRQHNAKSASLGRNVSGAAQLEHARSWSSKDLATTE
PSYNNSTVSVTNGSNTSNNGNNTSGSSTNKKSSHQVVSEMLHELYNSLHGNEMADSSEPY
HADTLLHAVQDVNATFEGNQQQDAHEFLMCLLNCIRETNQSLLKAIADCPEVIANGYIAN
PDDADTVDALERSDAGGNYAMLGTAGNGSIATSQSQNTTTTKTSFFSRKSKRKDDVKSSK
ATRLQSPLKDNSPTTASGMPPQAHAASNSLFYLNTVDLSGASGATTGTATPSASVSMTNA
PAPAKYSSDDEISSAIQLKDKMRLEERIRELNLNFFNKDFEGIVVLTTKCLSCETITRQK
QGMLDISVPVPISGYDTAELQEKPSAYIQNSCITREYFRGDNKYSCNQCTGYTEAIRSIS
YEVLPRLLVIQLNRFSGGMEKVSTYVPTTFTLPCFCAKCCELSDANKLHVYKLYSVITHV
GATLTVGHYIAYTCILDLASDYVNCPKDRRNNTSSSASGQQQQASSSAGGNENTAPSSNN
GSISIASTPVSAAASALASSGTSLIKKMKFGRSKASSSGDMSKNVKQLNGFTSKTITNGI
GKLSMNTTCHGVNCCAMRLCCSQQASAAGSNSASSSDFSEESLQNGSNSNLSYGSSASNN
CPPYPVGYGSTGRGGVKANYAANSSEPTWYMCDDDKVKAMSQRDFEELLSPTRKITITPY
LLFYARFDLQPAQATPPKPNASSTPPPPPTASHQQQQQQPQSSWSNDNLQSGLHKM
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaatatgacataaatgagctgagagaggaacaagcccgtcttccgacaagcacc
agcagcaccagcacaagcagcaaaaacaattgtcgcaataatcaacaacaactacaacaa
caaattcatattcaatcgccgaggcaagaaacaacaactttacacctactacaacaatca
caacaggaggcttccacaaacctaattgcaactgacgacccgcaacaattgtcgccgtcg
tcctcatactcctcggccacatatccagcgactcagcacgagtacacagatccaatcgta
gagccacccaaagccaaagttgaggtccaagtaccgaagcgtaggcgacagcgacgcgtt
tatgttgcagagttttcacgttgcgccagtctacgttcacggcaattggctcccgtcgag
gtaattcctctgccggaaataccactaactccttcgccaacgcccaccgaggttatcgag
gatcataaaagttattacataaagccagaacatttcaattccgagttctggaatcgcatt
gaggaggtgcccgaggtaaagccaacgggacgcaagagacgcggcgccgtcggttttagg
aatcgcaagcgtcgcaaccggcctgatctcgatacgtcgtcgatcttctcgccggagacg
acggcggcaatagcggcggcccaaattgagctcgattcggccaagccggtgtcacgtgca
tttcgcaagcgaaaactgagcagcggcaacatgtccttatacgatcgacgctaccagacg
tccaacgatgaacagcggcgggtggccaacggttatgccggtggcaatgggctgcgagcg
ggcaattcagccggtgccggtgacatcgatacagcagatctgcaaattacccatcattat
tatgtgcccggtgtggggggcagcagcagctcgagcattgcaaccactggcactggctcg
ggactcaatgggagtgtcggtggtggcagcggctcagcagcattgaatcatgtgcccgcc
atgggcacactgtgcaacattggcaacacatgctatctaaattctgtggtgtatacgcta
cgttgtgccccgcacttcctgcacaatctgcaccatcttatccacgacctgaatgtggtg
cagcagacgatgttgcgacagcacaacgccaaatctgcatcgctaggacgcaatgtgagc
ggagctgctcaattagagcatgcgcgcagttggagcagcaaggatttggccaccacagag
ccatcgtacaacaacagcaccgtcagcgtcacaaatggcagcaacaccagcaacaatggc
aacaacaccagcggaagcagcaccaataaaaagtcatctcatcaagtggttagcgagatg
ttgcatgaattgtacaacagtctgcatggcaatgaaatggccgattccagtgaaccgtat
catgcggacaccctgctccatgccgtgcaggatgtgaatgccacgttcgagggcaatcag
cagcaggatgcgcacgagtttctcatgtgtctcctcaattgtatacgtgaaacgaatcag
tcgctcctcaaggccattgccgattgtcccgaagtcattgcaaatggttacattgccaat
cccgatgatgcagacacagtagatgccctggaacgctctgatgcgggcggcaattatgca
atgttgggcactgctgggaatggttcgatagcaactagtcaaagtcaaaataccacaacg
acaaaaacatcgttcttctcgcgcaagtcaaagagaaaagatgatgtgaaatcgtcgaag
gcgacacgcttgcagtcgccgcttaaggacaacagtccgacaacagctagtggcatgcca
ccacaagcgcatgccgcctccaatagtcttttctatttgaatacagtcgatctcagcggc
gctagcggcgccacaacaggcacagccacaccatcagcttcagtgtcaatgacaaatgca
cctgcgcctgctaaatattccagtgatgatgagataagttcagccattcagctcaaggat
aagatgcgcctggaggagcgtatacgtgaactgaatttgaactttttcaacaaagatttc
gagggcattgtggtgctgaccaccaaatgcctgagctgtgagacgattacgcgtcagaag
cagggcatgctcgatatctcagtacctgtgccgatttcgggttacgatactgccgagttg
caggaaaaacccagcgcttatatacagaactcgtgcataacccgtgaatattttcgaggc
gataacaagtacagctgtaatcagtgtacgggctacactgaagccatacgctcgatatcg
tacgaagtgctgccgcgtctgttggtcatccagttgaatcgcttctcgggtggcatggag
aaggtcagcacgtatgtgccgacaacatttacgctgccctgcttctgtgccaagtgttgt
gagctaagcgatgccaacaaactgcacgtctacaagctgtatagtgttatcacacatgtg
ggcgccacactgacagtgggccattacatagcatacacatgcattctggatttggccagt
gattatgttaattgccccaaggatcgtcgcaataatacatcatcatcggcaagtgggcag
caacagcaggcgtcatcatcggccggtggcaatgagaacactgcacctagcagcaacaat
ggcagcatcagcattgccagcacacccgtctcggcggctgcctcagcgctggcttcgtcc
ggcaccagtctgattaagaagatgaaatttggtcgcagcaaggcgtcgagcagcggcgat
atgagtaaaaatgttaaacaattgaatggctttacgagcaaaacgattaccaatggcatt
ggcaagctgagcatgaataccacatgccatggcgtcaattgttgtgcgatgcgtctgtgt
tgcagccaacaggcaagtgccgcgggcagcaacagtgccagcagcagtgatttcagtgag
gaatccctgcaaaatgggagcaacagtaatcttagctatggcagctccgccagcaataat
tgtccgccatatccggtggggtatgggagcacgggtcgcggcggtgtcaaggccaactat
gcggcgaacagcagcgagcccacttggtatatgtgcgatgatgacaaggtcaaggcgatg
tcacagcgcgatttcgaggagctgctgtcgcccacacgcaaaataaccataacaccctat
ctactattctatgcccgtttcgatttgcagccggcgcaggcgacaccaccaaagccgaat
gcatcgtcaacgccaccgccgccaccgacagcgtcacatcagcagcagcagcagcaacca
caaagctcttggtcgaatgataatctgcaaagtggcttgcacaaaatgtga

DBGET integrated database retrieval system