KEGG   Drosophila grimshawi: Dgri_GH14560Help
Entry
Dgri_GH14560      CDS       T01061                                 

Definition
GH14560 gene product from transcript GH14560-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dgr  Drosophila grimshawi
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dgri_GH14560
Enzymes [BR:dgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dgri_GH14560
Glycosyltransferases [BR:dgr01003]
 Polysaccharide
  Storage polysaccharide
   Dgri_GH14560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 711 aa AA seqDB search
MLRRQMSYRFEDQDASSMAVRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVA
NKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEACARTEMEEMEFPRGNPLLDAVNTMRS
RGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWDKCHIGIPHMDIETNDAIILGF
MIAEFLEEFRNCADGYSQRNDLSAPRIVAHFHEWQAGVALIVLRTRQIEIATVFTTHATL
LGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEH
LLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHMDFDLDKTLYFFI
AGRYEFGNKGADIFIESLARLNAMLKHERPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQ
LRDTITNVQQAVGKRMFDTCVKGHIPSPDELLQKDDLVKIKRCMFAMQRDTMPPVTTHNV
SDDWNDPVLSAIRRCNLFNSVHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSY
YEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHISDPKSYGIYIVDRRYIGLENSVQQLS
SFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDETSTYG
SRSNLLFSRPQSEPSSPTSSRHTTPAPSVHGSDDEEDSVDEETELKELGIK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcgtcaaatgtcgtatcgctttgaagatcaagatgcttcgtctatggccgtg
cggatgaatcgacgattttcacgcgtggagtccggcgcggacctgaaggattatttcgat
cgcggcgatattgcatcgcgcgagaatcgctggaactttgaggtcgcatgggaggtggcc
aacaaagtgggcggcatttatacggtgatccggtcgaaggcctatgtctccaccgaggag
atgggcgagcagctgtgcatgatgggtccctacaaggaggcgtgtgcccgcaccgaaatg
gaggaaatggaatttccacgcggcaatccgttgctcgatgctgtcaacacgatgcgttcg
cgaggctacaaaattcacactggtcgctggcttgtcgatggcaatccgcagctgatattg
tttgacattggctcagccgcctggaagctggatcagttcaagtcggagatgtgggacaag
tgccacattggcataccacatatggatattgagacaaacgatgccattatattgggcttt
atgattgccgagttcctagaggagtttcgcaactgtgccgatggctactcgcaacgcaat
gatctcagtgcaccgcggatcgttgcccactttcacgagtggcaggctggtgtggcactc
atagtgctgcgcacccgtcaaatcgagattgccaccgtgttcaccacgcatgcgacgctc
ctcggtcgctatctgtgcgccggcaacaccgatttctacaacaatctcgataaattcgct
gtggacgaggaggctggcaagcgtcagatctatcatcgctattgcctcgagcgtggcgcc
acacatctggcgcatgtcttcaccaccgtatcggagatcacgggctacgaggcggagcac
ctgctcaaacgcaaaccggacatcataacgccaaacggcctgaacgtgaagaagttctcg
gccattcatgagttccagaatttgcatgccgttgccaaggagaaaatcaatgagtttgta
cgcggccatttctatggccatatggacttcgatctggacaagacgctgtacttcttcatt
gccggccgttatgagtttggcaacaagggcgctgatatattcatcgaatcgctggcccgc
ctcaatgcgatgctgaagcacgagcgtcccgacaccacggtggtggccttcctcattttc
cccactaagacgaataacttcaatgtggactcgctgcgtggccatgcggtcatcaagcag
ctgcgcgacaccatcaccaatgtgcagcaggcggttggcaagcgcatgttcgatacatgc
gtcaagggccacatacccagtcccgatgagctgctccaaaaggatgatctggtgaagatc
aagcgctgtatgtttgccatgcaacgcgatacaatgccaccggttaccacccacaatgtg
tcagatgattggaatgatccggtcctatcggcgattcgtcgctgtaatttgttcaattcg
gtgcacgatcgcgtaaaaatggtcttccacccggagttcttgacttcaacgaatccgttg
tttggcatcgattacgaggagtttgtccgtggctgccatttgggtgtgttcccatcgtac
tacgaaccatggggctatacaccggccgagtgcaccgtcatgggcataccaagtgtgacc
acaaatctgtcgggattcggttgtttcatgcaggagcacatcagtgatcccaaatcctat
ggcatctacattgtcgatcgccgctacattggcctggagaacagcgtccaacagctgtcc
agcttcatgatggagttctcgcgtctgaatcgccgccagcgcatcattcagcgcaatcgc
accgagcgcctcagcgatttgctggactggcgtacgctgggcatttactacagacaggct
agggtgaaggccttgcaggccgtctatcccgactatgtggacgagacctccacgtacggt
tctcgcagcaatttgctgttctcacgtccacagagtgagccatcaagtcccacgtcgtca
cgccacactacgccagcgccctcggtgcacggctccgatgacgaggaggactctgtagat
gaggaaactgagttgaaagaattgggtattaagtaa

DBGET integrated database retrieval system