KEGG   Drosophila grimshawi: Dgri_GH14568Help
Entry
Dgri_GH14568      CDS       T01061                                 

Definition
GH14568 gene product from transcript GH14568-RA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dgr  Drosophila grimshawi
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dgr00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 655 aa AA seqDB search
MSKSQERSTSSATSTPNNNTSDDLHNVSDTFYTSQRKGSHVFRVRLDASGFTLQRESPSG
VTIKEQTVKICDIVGARCMRLKKSPRSLTRCACVNPGTPAAAAAAASHRKTGTPSRCSTA
SKEDYGACDGGDGSAYLYLFAYVLKKKSLRSTLHRERTVLTLRFRSFDTFEDNMREADRW
YRALRWQLHHTLEPTFVERLDEARRRRILVMLNPKSGSGNAREVFNMHVAPVLNEAEVPY
DLYVTKHSNYAIEFMGNRRLDDWCTILSVGGDGLFHEIINGLLRRPDWSQVLDSIALAII
PCGSGNGLARSIAHGYNEPYFSNPVLGAALTAISGRSSPLDVVRVQLESRVMFSFLSIGW
GLISDVDIESECIRMFGYQRFTIWTLYRLANLRTYNGKISYLLADEATEPHAGHAAQSEQ
LLKMPSSRSCNMHIDKLSNATSYRRSTEYLPSEFEDVISLETSINQSFRSRCDSWLSGGS
RRSCYYSISESVYHSLADESEFTQPSTATVTGLETSQLSFGPSSSLPALDEPLPAADGWL
VEEGEFVMMHAVYQSHLGIDCHFAPKAQLNDGKIYLVLIRGGISRPHLLSFLYNMSTGTH
LPEKNNDYVKVLQVRAFRLEPHDNHGIITVDGEQIEFGPLQAEILPGISRVMIPK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatctcaggagaggagcacaagctccgctacctccacacccaacaacaacaca
tccgacgaccttcacaatgtctccgacacattctacaccagccagcgcaaaggcagccac
gtatttcgcgttcgcctcgatgccagcggattcacgctgcagcgcgaatctcccagtggg
gtcaccatcaaggagcagacggtgaaaatatgtgatattgtcggtgcacgctgcatgcgc
ctgaagaaatcaccacgcagtctgaccagatgtgcctgcgtcaatcccggtactccggca
gcagctgcggccgctgccagccatcgcaaaactggcacaccgagcaggtgcagcacggcc
agcaaggaggattatggtgcctgcgatggcggcgatggtagcgcctatctgtatctcttt
gcctatgtgctgaagaagaagagcttgaggagcaccctgcaccgggagcgcactgtgctg
acactgcgctttcgctcctttgacacgtttgaggataatatgcgtgaggcggatcgctgg
tatcgtgccctgcgctggcagctccatcacacgctggagcccacgtttgtggagcgactg
gatgaggcacggcgtcgtcgcatcctcgtcatgctcaatcccaagtcggggtcgggcaat
gcgcgcgaggtgttcaacatgcatgtggcgcccgtgctcaacgaggctgaggtgccctac
gatctgtacgtaacgaagcattccaactatgccatcgaatttatgggcaatcgtcgcctg
gatgactggtgcaccattttgtccgtgggcggcgacggtctcttccacgagattatcaac
gggctgttgcgacgcccggactggtctcaagtcctcgacagcattgcactggccatcata
ccctgtggctccggcaatggactggcccgttccatagcgcatggctacaatgaaccgtat
ttcagtaatcctgttctgggtgccgcactgaccgccatcagcggacgcagctcgccgttg
gatgtggtgcgtgtgcagctggagagtcgcgtcatgttctcgttcctctccattggctgg
ggcctgatctcggatgtggacattgagagcgagtgcatacgcatgtttggctatcagcgc
ttcaccatttggacgctttatcgcctggccaatttgcgcacgtacaatggcaagattagc
tatctgctcgctgacgaggcgacggagccgcatgctggacacgctgcgcagtcggagcag
ctgctaaagatgccgtcgagtcgcagctgcaacatgcatatcgataagctgtccaatgcg
accagttatcgccgctccacggaatatttgccgtctgaattcgaggacgtcatctcactg
gagacgtccataaatcagtcgttccgatcgcgttgcgacagttggctatcgggtggttcg
cgtcgcagctgctactattccatatcagagagtgtctatcacagcttggcggacgaaagc
gaattcactcagccatcgacggcaactgtgacgggcttggagacgagccagctgagcttt
gggccgagcagcagtctgccagcgttggatgagccgttaccggcagcggacggctggctg
gtggaggagggtgaattcgtaatgatgcatgccgtctatcagtcgcatctgggcatcgat
tgccattttgcgcccaaggcgcaattgaacgatggcaaaatctatttggttttaatacgc
ggcggcatcagtcgaccgcatctgttgagcttcctatacaatatgagcacgggcacccac
ctgcccgagaagaacaacgactatgtgaaggtgctccaggtacgtgcgttccgcttggag
ccgcacgacaatcacggcatcatcaccgtcgatggcgaacagatcgaatttggtccactt
caggccgaaatacttccaggcatttcacgtgtcatgataccaaaatag

DBGET integrated database retrieval system